| PDBID: | 9ht3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PA0884, the SBP component of a Pseudomonas aeruginosa PAO1 Tripartite ATP-independent Periplasmic (TRAP) transporter, complexed with itaconate | | Authors: | Herman, R., Mehboob, J., Elston, R., Afolabi, H., Kinniment-Williams, B.E., Wilkinson, A.J., Thomas, G.H. | | Deposition date: | 2024-12-19 | | Sequence: | >Entity 1
AQPIVIKFSHVVAENTPKGQGALLFKKLVEQRLGGRVEVDVYPNSSLFGDGKEMEALLLGDVQMLAPSLAKFEQYTRKVQIFDLPFLFDDIQAVDRFQRSPQGRALLTSMQGKGILGLAYWHNGMKQLSANRPLLEPEDARGLKFRVQASDVLNEQFRQLRAISRKMSFAEVYQGLQTGVVNGTENTWSNYESQKVNEVQKYFTESNHGLVDYMVITNAKFWNGLPADIREELQRIMDEVTVQVNLEAERLNRDARQRILASGASEIHTLSPQQRADWRQAMQPVWQKFRGNVGADLLQAAEASNRPD
|
|
| PDBID: | 9htd | | Status: | HPUB -- hold until publication | | Title: | Peptide-substrate-binding (PSB) domain of human type II collagen prolyl 4-hydroxylase complexed with Pro-Hyp-Gly-Pro-Ala-Gly-Pro-Hyp-Gly. | | Authors: | Sulu, R., Rahman, M.M., Wierenga, R.K., Koski, M.K. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht7 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 47, with P-site and A-site tRNAs | | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Tetraspanin CD82 Large Extracellular Loop (LEL) | | Authors: | Nagarathinam, K., Krey, T. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of YIUA from Yersinia ruckeri with Iron and nitrilotriacetic acid | | Authors: | Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht9 | | Status: | HPUB -- hold until publication | | Title: | CutC in complex with inhibitor1 | | Authors: | Petersen, J. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hs9 | | Status: | HPUB -- hold until publication | | Title: | Cytochrome P460 from Methyloccocus capsulatus (unclear crosslink from Lys), damage-free | | Authors: | Pfalzgraf, H.E., Adams, H.R., Sugimoto, H., Tosha, T., Horrell, S., Jaho, S., Beilsten-Edmands, J., Tews, I., Worrall, J.A.R., Owen, R.L., Hough, M.A. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht8 | | Status: | HPUB -- hold until publication | | Title: | Peptide-substrate-binding (PSB) domain of human type I collagen prolyl 4-hydroxylase complexed with Pro-Pro-Gly-Pro-Ala-Gly-Pro-Pro-Gly. | | Authors: | Sulu, R., Rahman, M.M., Wierenga, R.K., Koski, M.K. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htc | | Status: | HPUB -- hold until publication | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 1600 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htb | | Status: | HPUB -- hold until publication | | Title: | CutC in complex with inhibitor2 | | Authors: | Petersen, J. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htt | | Status: | HPUB -- hold until publication | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 0.19 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htv | | Status: | HPUB -- hold until publication | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 0.95 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9l3b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9l3g | | Status: | HPUB -- hold until publication | | Title: | Structure of the flotillin complex | | Authors: | Lu, M., Gao, N. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9l3f | | Status: | HOLD -- hold until a certain date | | Title: | Structure-Guided Design of Picomolar-level Macrocyclic TRPC5 Channel Inhibitors with Antidepressant Activity | | Authors: | Che, T., Zhang, J., Xiong, B., Cheng, X.Y. | | Deposition date: | 2024-12-18 | | Release date: | 2025-12-18 |
|
| PDBID: | 9l3l | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-12-18 | | Release date: | 2025-12-18 |
|
| PDBID: | 9l3i | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9l3k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9l3m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9l3n | | Status: | HPUB -- hold until publication | | Title: | Galectin-10/Charcot-Leyden Crystal(PEG8000, dagger-shape) | | Authors: | Cui, X., Tian, Y. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9mky | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9mks | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9mkr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9mkq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-18 |
|
