PDBID: | 9l5z | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-23 |
|
PDBID: | 9l60 | Status: | HPUB -- hold until publication | Title: | Gi-bound kappa opioid receptor in complex with dynorphin and positive allosteric modulator MPAM-15 | Authors: | Zhuang, Y., Wang, Y., Xu, Y., Luo, P., Xu, H.E. | Deposition date: | 2024-12-23 |
|
PDBID: | 9l5c | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-23 |
|
PDBID: | 9l5d | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-23 |
|
PDBID: | 9l5h | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-23 |
|
PDBID: | 9l5i | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-23 | Sequence: | >Entity 1 MSPQTETKASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLSHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGDRESTLGFVDLLRDDYVEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDNSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAVEGNEIIREACKWSPELAAACEVWKEITFNFPTIDKLDGQE
>Entity 2 MASSMLSSATMVASPAQATMVAPFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPDLTDSELAKEVDYLIRNKWIPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKPPSFTG
|
|
PDBID: | 9l5p | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-23 |
|
PDBID: | 9l5n | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-12-23 |
|
PDBID: | 9l5v | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-23 |
|
PDBID: | 9l5q | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-23 |
|
PDBID: | 9l5o | Status: | HPUB -- hold until publication | Title: | Crystal structure of the mutant Y549A of collagenase VhaC | Authors: | Zhao, W.X. | Deposition date: | 2024-12-23 |
|
PDBID: | 9l52 | Status: | HPUB -- hold until publication | Title: | The ring expansion oxygenase SpoC in complex with Fe and stipitaldehyde | Authors: | Liu, M., He, X. | Deposition date: | 2024-12-23 |
|
PDBID: | 9l5x | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of Klebsiella pneumoniae Enoyl-Acyl Carrier Protein Reductase (FabI) in complex with Triclosan | Authors: | Biswas, S., Patra, A., Kushwaha, G.S., Suar, M. | Deposition date: | 2024-12-23 | Release date: | 2025-12-23 |
|
PDBID: | 9l62 | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-23 |
|
PDBID: | 9l5y | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-23 |
|
PDBID: | 9l5w | Status: | HPUB -- hold until publication | Title: | FADD-DED filaments coordinate complex IIa assembly during TNF-induced apoptosis | Authors: | Tan, Y.B., Luo, D. | Deposition date: | 2024-12-23 |
|
PDBID: | 9l61 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of BRD2 BD2 domain in complex with small molecule inhibitor Mivebresib ABBV-075 | Authors: | Jwala, N., Vijayshankar, N., Thomas, A., NarasimhaRao, K. | Deposition date: | 2024-12-23 | Sequence: | >Entity 1 MGSSHHHHHHSSGLVPRGSHSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
|
|
PDBID: | 9mnp | Status: | HPUB -- hold until publication | Title: | Crystal structure of mutant variant of mAb CV3-25 Fab in complex with SARS-CoV-2 spike stem helix peptide | Authors: | Chandravanshi, M., Tolbert, W.D., Pazgier, M. | Deposition date: | 2024-12-23 |
|
PDBID: | 9mno | Status: | HPUB -- hold until publication | Title: | Structure of the TelA-associated type VII secretion system chaperone LcpA in complex with the chaperone binding site of TelA | Authors: | Garrett, S.R., Kim, Y., Whitney, J.C. | Deposition date: | 2024-12-23 |
|
PDBID: | 9mnr | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-12-23 | Release date: | 2025-12-23 |
|
PDBID: | 9mnq | Status: | HPUB -- hold until publication | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM10-30 | Authors: | Nguyen, T.K.Y., Wilson, I.A. | Deposition date: | 2024-12-23 |
|
PDBID: | 9mnt | Status: | HPUB -- hold until publication | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-73 | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | Deposition date: | 2024-12-23 |
|
PDBID: | 9mns | Status: | HPUB -- hold until publication | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-36 | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | Deposition date: | 2024-12-23 |
|
PDBID: | 9mnu | Status: | HPUB -- hold until publication | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM11-48 | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | Deposition date: | 2024-12-23 |
|
PDBID: | 9hum | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-12-23 | Release date: | 2025-12-23 |
|