| PDBID: | 9l68 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human STING in complex with F8W | | Authors: | Feng, Z.W., Zeng, T., Chen, M.R., Xiao, Y.B., Xu, X.L. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l63 | | Status: | HPUB -- hold until publication | | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | | Authors: | Jiang, J., Fang, P. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l64 | | Status: | HPUB -- hold until publication | | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | | Authors: | Jiang, J., Fang, P. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l65 | | Status: | HPUB -- hold until publication | | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | | Authors: | Jiang, J., Fang, P. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6e | | Status: | HPUB -- hold until publication | | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | | Authors: | Jiang, J., Fang, P. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6a | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRas G12D (GDP) in complex with compound 1 | | Authors: | Amano, Y., Tateishi, Y. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRas G12D (GDP) in complex with ASP3082 | | Authors: | Amano, Y., Tateishi, Y. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6j | | Status: | HPUB -- hold until publication | | Title: | Structural studies on the conformation changes induced by ligand binding in an Adenine phosphoribosyltransferase (FnAPRT) from Fusobacterium nucleatum | | Authors: | Kim, B., Hwang, J., Do, H., Lee, J.H. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6m | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of BRD2 BD1 domain in complex with small molecule inhibitor Isoxazole azepine compound. | | Authors: | Jwala, N., Vijayshankar, N., Thomas, A., NarasimhaRao, K. | | Deposition date: | 2024-12-24 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
|
|
| PDBID: | 9l6n | | Status: | HOLD -- hold until a certain date | | Title: | PEDV 3CLpro mutant (C144A) in complex with nsp5/6 peptite substrate | | Authors: | Zhang, Y., Zhang, D., Shi, Y.J., Peng, G.Q. | | Deposition date: | 2024-12-24 | | Release date: | 2025-12-24 |
|
| PDBID: | 9l6p | | Status: | HPUB -- hold until publication | | Title: | Cryo-electron microscopic structure of a highly efficient ochratoxin detoxification enzyme LlADH | | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., Niu, D., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Guo, R.-T., Chen, C.-C. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9mo3 | | Status: | HPUB -- hold until publication | | Title: | LINE-1 Reverse Transcriptase bound to an incorporated inhibitor-terminated DNA primer RNA template duplex and dTTP as the incoming base | | Authors: | Nichols, C., Viacava Follis, A. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9mo1 | | Status: | HPUB -- hold until publication | | Title: | LINE-1 Reverse Transcriptase bound to a DNA primer RNA template duplex and triphosphate nucleoside inhibitor as the incoming base | | Authors: | Nichols, C., Viacava Follis, A. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9mo2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9hv7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Tetraspanin TSPAN10mutant Large Extracellular Loop (LEL) | | Authors: | Nagarathinam, K., Krey, T. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9hv4 | | Status: | HPUB -- hold until publication | | Title: | CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. cofactor-monomer. | | Authors: | Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9hv5 | | Status: | HPUB -- hold until publication | | Title: | CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Cofactor/ligand-monomer | | Authors: | Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9hv6 | | Status: | HPUB -- hold until publication | | Title: | CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Total-monomer | | Authors: | Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9hv2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of tri-specific FMDV mAb-34 Fab | | Authors: | Ren, J., Duyvesteyn, H.M.E., Stuart, D.I. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9hv8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of tri-specific FMDV mAb-49 Fab | | Authors: | Ren, J., Duyvesteyn, H.M.E., Stuart, D.I. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9hv9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Fab34 complexed with a 7-mer peptide of FMDV VP1 | | Authors: | Ren, J., Duyvesteyn, H.M.E., Stuart, D.I. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l5m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l57 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l58 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-23 |
|
