PDBID: | 9lf0 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9lex | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9ley | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9lez | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9lf1 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9mra | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 | Sequence: | >Entity 1 GIVEQCCTSICSLYQLENYCN
>Entity 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
PDBID: | 9mr9 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9mrh | Status: | HOLD -- hold until a certain date | Title: | Fluorescence lifetime-readout citrate sensor | Authors: | Rosen, P.C., Yellen, G., Lim, D.C. | Deposition date: | 2025-01-07 | Release date: | 2026-01-07 |
|
PDBID: | 9mrg | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of KwaA tetramer with C2 symmetry | Authors: | Zhang, Z., Patel, D.J. | Deposition date: | 2025-01-07 |
|
PDBID: | 9hwz | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-06 |
|
PDBID: | 9hx0 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-06 |
|
PDBID: | 9hwo | Status: | AUTH -- processed, waiting for author review and approval | Title: | CK2 catalytic subunit Alpha''C336S in complex with F2X entry screen fragment C02 | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-01-06 |
|
PDBID: | 9hwu | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-06 |
|
PDBID: | 9hwv | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-06 |
|
PDBID: | 9hww | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-06 |
|
PDBID: | 9hwx | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-06 |
|
PDBID: | 9hwq | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-06 |
|
PDBID: | 9hx1 | Status: | HPUB -- hold until publication | Title: | Fab fragment of an antibody that recognises all conformations of alpha-1-antitrypsin | Authors: | Wan, M.S.M., Lomas, D.A., Irving, J.A. | Deposition date: | 2025-01-06 |
|
PDBID: | 9hx4 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-06 |
|
PDBID: | 9hwy | Status: | HPUB -- hold until publication | Title: | Structure of SARS-CoV-2 spike protein at pH 7.4 (RBD Opened state) | Authors: | Jana, S., Lorenz, U.J. | Deposition date: | 2025-01-06 |
|
PDBID: | 9hx3 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-06 |
|
PDBID: | 9hwp | Status: | HPUB -- hold until publication | Title: | CK2 catalytic subunit Alpha''C336S in complex with fragment C02 | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-01-06 |
|
PDBID: | 9hwr | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-06 |
|
PDBID: | 9hws | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-06 |
|
PDBID: | 9hwt | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-06 |
|