PDBID: | 9lez | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9lf1 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9mr9 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9mrh | Status: | HOLD -- hold until a certain date | Title: | Fluorescence lifetime-readout citrate sensor | Authors: | Rosen, P.C., Yellen, G., Lim, D.C. | Deposition date: | 2025-01-07 | Release date: | 2026-01-07 |
|
PDBID: | 9mrg | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of KwaA tetramer with C2 symmetry | Authors: | Zhang, Z., Patel, D.J. | Deposition date: | 2025-01-07 |
|
PDBID: | 9mra | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 | Sequence: | >Entity 1 GIVEQCCTSICSLYQLENYCN
>Entity 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
PDBID: | 9hxl | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9hxb | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9hx9 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9hxm | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9hxn | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-01-07 |
|
PDBID: | 9hxd | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9hxe | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9hxf | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9hxg | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9hxk | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9hxh | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9hxi | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9hxo | Status: | HPUB -- hold until publication | Title: | A01 mAbs bound to cobratoxin at pH 6.0 | Authors: | Wade, J.W., Bohn, M.F., Laustsen, A.H., Morth, J.P. | Deposition date: | 2025-01-07 |
|
PDBID: | 9hx5 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9hx6 | Status: | HPUB -- hold until publication | Title: | CK2 catalytic subunit Alpha''C336S in complex with F2X entry screen fragment F02 | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-01-07 |
|
PDBID: | 9hx8 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9hx7 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-07 |
|
PDBID: | 9hx0 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-06 |
|
PDBID: | 9ldh | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-06 |
|