| PDBID: | 9lkc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lko | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkr | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the bromodomain of human BRD9 in complex with the inhibitor Y22076 | | Authors: | Chen, Z., Zhang, C., Xu, H., Wu, X., Zhang, Y., Xu, Y. | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9mvx | | Status: | PROC -- to be processed | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9mw1 | | Status: | HPUB -- hold until publication | | Title: | Structure of SARM1 TIR domain bound to G8758 | | Authors: | Wallweber, H.A., Sudhamsu, J. | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9mvw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 | | Sequence: | >Entity 1
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYIFAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
>Entity 2
(ACE)RRKWQKTGNAVRAIGRLSSM(NH2)
|
|
| PDBID: | 9mw2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9mw3 | | Status: | HPUB -- hold until publication | | Title: | Structure of SARM1 TIR domain bound to G2756 | | Authors: | Wallweber, H.A., Sudhamsu, J. | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9mw4 | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of feline coronavirus UU23 main protease with Pfizer intravenous compound PF-00835231 | | Authors: | Shaqra, A.M., Maryam, A., Schiffer, C.A. | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9i0i | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-15 | | Release date: | 2026-01-15 |
|
| PDBID: | 9i0j | | Status: | HOLD -- hold until a certain date | | Title: | Structure of METTL21A (K215A mutant) bound to compound 16 | | Authors: | Peng, L., Metzger, E., Schuele, R. | | Deposition date: | 2025-01-15 | | Release date: | 2026-01-15 |
|
| PDBID: | 9i0x | | Status: | HOLD -- hold until a certain date | | Title: | Structure of METTL21A (K215A mutant) bound to compound (S)-29 | | Authors: | Peng, L., Metzger, E., Schuele, R. | | Deposition date: | 2025-01-15 | | Release date: | 2026-01-15 |
|
| PDBID: | 9i0p | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CR57 diabody-2, a homospecific diabody with minimal linker | | Authors: | Kedari, A., Rissanen, I. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9i14 | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF HCT15 POLYSOMES IN HYBRID-PRE STATE | | Authors: | Rajan, K.S., Yonath, A. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9i0f | | Status: | REFI -- re-refined entry | | Title: | Revisited AvNifEN crystal structure | | Authors: | Paya Tormo, L., Nguyen, T.Q., Fyfe, C., Basbous, H., Dobrzynska, K., Echavarri-Erasun, C., Martin, L., Caserta, G., Legrand, P., Thorn, A., Amara, P., Schoehn, G., Cherrier, M.V., Rubio, L.M., Nicolet, Y. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9i0g | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of holo-GmNifEN | | Authors: | Paya Tormo, L., Nguyen, T.Q., Fyfe, C., Basbous, H., Dobrzynska, K., Echavarri-Erasun, C., Martin, L., Caserta, G., Legrand, P., Thorn, A., Amara, P., Schoehn, G., Cherrier, M.V., Rubio, L.M., Nicolet, Y. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9i0h | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of transit-GmNifEN | | Authors: | Paya Tormo, L., Nguyen, T.Q., Fyfe, C., Basbous, H., Dobrzynska, K., Echavarri-Erasun, C., Martin, L., Caserta, G., Legrand, P., Thorn, A., Amara, P., Schoehn, G., Cherrier, M.V., Rubio, L.M., Nicolet, Y. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9i0s | | Status: | HPUB -- hold until publication | | Title: | Structure of RecQL-ADP complex from Bos taurus | | Authors: | Song, Z.Y., Liu, N.N., Ai, X., Rety, S., Xi, X.G. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9i0q | | Status: | HPUB -- hold until publication | | Title: | CK2alpha in complex with CX-4945 AND the alphaD pocket ligand 3,4-dichlorophenylethylamine (DPA) | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-01-15 |
|
