| PDBID: | 9lpy | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of GH1 beta-glucosidase Td2F2 2F-Glc complex at cryogenic temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9lpz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rice PHS1-DPE1 complex | | Authors: | Liu, J., Yan, J. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1j | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1g | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1i | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1l | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1h | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1p | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of GLP-1R-Gs complex with SRB103H | | Authors: | Zhang, X., Belousoff, M.J., Mohebali, N., Wootten, D., Sexton, P.M. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1q | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of GCGR-Gs complex with SRB103H | | Authors: | Zhang, X., Mohebali, N., Belousoff, M.J., Wootten, D., Sexton, P.M. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9i4k | | Status: | HPUB -- hold until publication | | Title: | Galectin-1 in Complex with Methyl 6-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 | | Sequence: | >Entity 1
SMACGLVASNLNLKPGE(CME)LRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEV(CME)ITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIK(CME)VAFD
|
|
| PDBID: | 9i4l | | Status: | HPUB -- hold until publication | | Title: | Galectin-1 in Complex with Methyl 2''-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4m | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Galectin-1 in Complex with Methyl 3''-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4n | | Status: | HPUB -- hold until publication | | Title: | Galectin-3 in Complex with Methyl 6-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4o | | Status: | HPUB -- hold until publication | | Title: | Galectin-3 in Complex with Methyl 2''-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4p | | Status: | HPUB -- hold until publication | | Title: | Galectin-3 in Complex with Methyl 3''-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4q | | Status: | HPUB -- hold until publication | | Title: | SSX structure of dye-type peroxidase DtpB from Streptomyces lividans | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9lpk | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9lpl | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | E. coli FabF mutant -C163Q | | Authors: | Chen, L., Huang, Y. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9lpn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9lpo | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9lpp | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9lpq | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
