| PDBID: | 9lt9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Gle1 from Debaryomyces hansenii | | Authors: | Jang, M.J., Chang, J.H. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lt8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9ltb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n6v | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n74 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n7b | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n6w | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n6x | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n6y | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n6z | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n70 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n72 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n73 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n75 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n76 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n78 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n79 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n7a | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n77 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n6a | | Status: | HPUB -- hold until publication | | Title: | GP23 C-termimal receptor binding domain from TM4 phage | | Authors: | Di, D., Rousseau, S., Krieger, I.V., Sacchettini, J.C. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n6e | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n6d | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n6t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n6f | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease M165I covalently bound to inhibitor GRL-051-22 at 1.90 A | | Authors: | Beechboard, S.N., Meadows, M.S., Ghosh, A.K., Mesecar, A.D. | | Deposition date: | 2025-02-05 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHIELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9n6u | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-05 | | Release date: | 2026-02-05 |
|
