| PDBID: | 9lpn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9lpo | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9lpp | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9lpq | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9lps | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 7i09 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000020269204 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i0m | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with Z1302549938 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9n1b | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9n1c | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9n1d | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i3s | | Status: | HPUB -- hold until publication | | Title: | Photosynthetic A10B10 glyceraldehyde-3-phospahte dehydrogenase from Spinacia oleracea. | | Authors: | Marotta, R., Fermani, S., Sparla, F., Del Giudice, A. | | Deposition date: | 2025-01-24 | | Sequence: | >Entity 1
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE
>Entity 2
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQA
|
|
| PDBID: | 9i4a | | Status: | HPUB -- hold until publication | | Title: | Cobalamin-binding chimera 10 (Cob10) (crystallization condition 2) | | Authors: | Romero-Romero, S., Koch, J.-S., Hoecker, B. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i49 | | Status: | HPUB -- hold until publication | | Title: | Cobalamin-binding chimera 10 (Cob10) (crystallization condition 1) | | Authors: | Koch, J.-S., Romero-Romero, S., Hoecker, B. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3v | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4i | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3y | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN MONOACYLGLYCEROL LIPASE WITH COMPOUND 17 | | Authors: | Walter, A., Atz, K., Stenzhorn, Y., Nippa, D., Grether, U., Kuhn, B., Martin, R., Benz, J. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3u | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the AGR2 dimer in complex with the monomeric IRE1beta luminal domain | | Authors: | Yan, Y., Hardwick, S., Tung, J., Ron, D. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i44 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i42 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-2D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3w | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-8C Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i43 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-9D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3x | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-11B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3z | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-12D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i41 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-3-3C Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i40 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-3-4D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
