| PDBID: | 9n1z | | Status: | HPUB -- hold until publication | | Title: | Structure of C3d Bound to a Fragment of FHR-2 | | Authors: | Duan, H., Geisbrecht, B.V. | | Deposition date: | 2025-01-27 |
|
| PDBID: | 9n20 | | Status: | HPUB -- hold until publication | | Title: | Structure of C3d Bound to a Fragment of FHR-2 and S. aureus Efb-C | | Authors: | Duan, H., Geisbrecht, B.V. | | Deposition date: | 2025-01-27 |
|
| PDBID: | 9n22 | | Status: | HPUB -- hold until publication | | Title: | Y20S (Sec18-Sec17-Sec9-Sso1-Snc1) EDTA - Class 2 | | Authors: | Khan, Y.A., Brunger, A.T. | | Deposition date: | 2025-01-27 |
|
| PDBID: | 9n23 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-27 |
|
| PDBID: | 9i4t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9i4r | | Status: | HPUB -- hold until publication | | Title: | N-terminal Oic streptag II in Sav E44V-S45T-V47R-D67A-K121R variant | | Authors: | Wang, W., Lau, K., Pojer, F., Larabi, A. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9i4s | | Status: | HPUB -- hold until publication | | Title: | DtpB in complex with photocaged nitric oxide, 1.24 s, 64.4 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9i4u | | Status: | HPUB -- hold until publication | | Title: | DtpB in complex with photocaged nitric oxide, 1.24 s, 32.2 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9lpw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9lpv | | Status: | HPUB -- hold until publication | | Title: | Neutron structure of GH1 beta-glucosidase Td2F2 2F-Glc complex at room temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9lpx | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of GH1 beta-glucosidase Td2F2 2F-Glc complex at room temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9lpy | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of GH1 beta-glucosidase Td2F2 2F-Glc complex at cryogenic temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9lpz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rice PHS1-DPE1 complex | | Authors: | Liu, J., Yan, J. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1j | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1g | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1i | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1l | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1h | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1p | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of GLP-1R-Gs complex with SRB103H | | Authors: | Zhang, X., Belousoff, M.J., Mohebali, N., Wootten, D., Sexton, P.M. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1q | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of GCGR-Gs complex with SRB103H | | Authors: | Zhang, X., Mohebali, N., Belousoff, M.J., Wootten, D., Sexton, P.M. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9i4k | | Status: | HPUB -- hold until publication | | Title: | Galectin-1 in Complex with Methyl 6-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 | | Sequence: | >Entity 1
SMACGLVASNLNLKPGE(CME)LRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEV(CME)ITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIK(CME)VAFD
|
|
| PDBID: | 9i4l | | Status: | HPUB -- hold until publication | | Title: | Galectin-1 in Complex with Methyl 2''-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
