| PDBID: | 9na1 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9nad | | Status: | HPUB -- hold until publication | | Title: | Human GSTO1-1 complexed with C5-1 | | Authors: | Oakley, A.J. | | Deposition date: | 2025-02-11 | | Sequence: | >Entity 1
SGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
|
|
| PDBID: | 9na7 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iaf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9iae | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9iag | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9iai | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9lut | | Status: | HPUB -- hold until publication | | Title: | PSI-LHCI supercomplex binding with 4 Lhcas from M. polymorpha | | Authors: | Tsai, P.-C., Akita, F. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luu | | Status: | HPUB -- hold until publication | | Title: | PSI-4 LHCI dimer supercomplex from M. polymorpha | | Authors: | Tsai, P.-C., La Rocca, R., Shen, J.-R., Akita, F. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luw | | Status: | HPUB -- hold until publication | | Title: | Enhancing Monodispersity and Thermal Stability of Human H-Ferritin for Improved Applications in Nanocarrier Systems | | Authors: | Gu, C.K., Wang, S.J. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9lus | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n9g | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n9e | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n9f | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n9h | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n9i | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n98 | | Status: | HPUB -- hold until publication | | Title: | Main Protease of HKU4 in complex with AVI-8122 | | Authors: | Chen, P., Lu, J., Lemieux, M.J. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n99 | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Main protease in complex with AVI-8122 | | Authors: | Chen, P., Lu, J., Lemieux, M.J. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n9c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n97 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of an anti-HIV_scFv design with disulfide bonds eliminated | | Authors: | Chen, S.H., Snow, C.D., Deroo, J.B., Zhao, N. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n8x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n94 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n96 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
