PDBID: | 9ifz | Status: | HPUB -- hold until publication | Title: | FSP1 (tetrapod ancestor) bound to FAD | Authors: | Cecchini, D., Mattevi, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9iff | Status: | HPUB -- hold until publication | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z2856434836 | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifd | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifg | Status: | HPUB -- hold until publication | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z2204875953 | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifh | Status: | HPUB -- hold until publication | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z2856434890 | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifi | Status: | HPUB -- hold until publication | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z32399802 | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifr | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifj | Status: | HPUB -- hold until publication | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z2017861827 | Authors: | Exertier, C., Fiorillo, A., Ilari, A., Antonelli, L. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifl | Status: | HPUB -- hold until publication | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z319545618 | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9lxf | Status: | HOLD -- hold until a certain date | Deposition date: | 2025-02-18 | Release date: | 2026-02-18 |
|
PDBID: | 9lxe | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-02-18 | Release date: | 2026-02-18 |
|
PDBID: | 9lxd | Status: | HOLD -- hold until a certain date | Deposition date: | 2025-02-18 | Release date: | 2026-02-18 |
|
PDBID: | 9lxk | Status: | HOLD -- hold until a certain date | Deposition date: | 2025-02-18 | Release date: | 2026-02-18 |
|
PDBID: | 9lxh | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-18 |
|
PDBID: | 9lxi | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-18 | Sequence: | >Entity 1 MAQTVGVIGTGLMGSALVNTLLKAGTKVTVWDGRKEATAGVVANGAKLASSFVELVNGNDVVISIVSSASIGANLFREHVSQLNLDGRYVANLSTAMPEDGEAFRDIIESNGGRFISAAISSYPDLIGGPYTAIQYAGKEEVWRAVEATFKPLAPEGTIYTGANLAVPPIVDAAMTGSFYAVSLAGFLEAAAYAKARGVSPSQLGDFADKMLDLVRYKVHKSIREIEANNFETIQATVDVYLDAVIQWRDALKDVGLRASHIAALADDLTVTRDAGYGSLGFTAQFLTASKVD
|
|
PDBID: | 9lxj | Status: | HOLD -- hold until a certain date | Deposition date: | 2025-02-18 | Release date: | 2026-02-18 |
|
PDBID: | 9lxm | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-18 |
|
PDBID: | 9ndv | Status: | HPUB -- hold until publication | Title: | Scaffold attached to quinine-I aptamer (Tonic) local refinement of aptamer | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ndd | Status: | HPUB -- hold until publication | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer, combined core plus aptamer | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ndr | Status: | HPUB -- hold until publication | Title: | The 1.22 Angstrom crystal structure of galactose oxidase variant with genetically incorporated F2-Tyr495 | Authors: | Liu, A., Li, J., Graciano, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ndu | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Ferric Human ADO C18S/C239S Variant in Complex with Hydralazine at 1.98 Angstrom Resolution | Authors: | Liu, A., Li, J., Duan, R. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ndm | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-18 |
|
PDBID: | 9ndy | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-18 |
|
PDBID: | 9ndj | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the endogenous ClpP1/ClpP2 heterocomplex from Pseudomonas aeruginosa bound to the AAA+ ClpX unfoldase. | Authors: | Ghanbarpour, A., Zhang, J.J., Baker, T.A., Davis, J.H., Sauer, R.T. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ndp | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-02-18 |
|