| PDBID: | 9q9b | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment C07 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9c | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D04 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9d | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D04 and CX-4945 (Silmitasertib) | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9g | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D10 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Borrelia burgdorferi BB0238-BB0323 complex | | Authors: | Brangulis, K. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9f | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9r | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-26 | | Release date: | 2026-02-26 |
|
| PDBID: | 9m1k | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the TBC-DE-Arl2-beta-tubulin complex with GTP | | Authors: | Seong, Y.J., Kim, H.M., Byun, K.M., Park, Y.W., Roh, S.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1l | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the TBC-DE-Arl2-alpha-beta-tubulin complex with GTP | | Authors: | Seong, Y.J., Kim, H.M., Byun, K.M., Park, Y.W., Roh, S.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1r | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m20 | | Status: | HPUB -- hold until publication | | Title: | GmMAN19-1 from Glycine max | | Authors: | Lin, C.J., Hsu, C.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m21 | | Status: | HPUB -- hold until publication | | Title: | GmMAN19-1 from Glycine max in complex with mannopentaose | | Authors: | Lin, C.J., Hsu, C.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1m | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the TBC-DEC-Arl2-alpha-beta-tubulin complex with GDP-AlFx | | Authors: | Seong, Y.J., Kim, H.M., Byun, K.M., Park, Y.W., Roh, S.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of N-prenyltransferase DsKabA | | Authors: | Huang, W.J., Hsu, C.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1z | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of MAP2K6 complexed with 5Z-7-oxozeaenol | | Authors: | Yumura, S., Kinoshita, T. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1p | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the histamine-bound zTAAR13d-Gs complex | | Authors: | Zheng, Y., Zhao, S.W. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1v | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of N-terminal domain of hypothetical protein Rv1421 from Mycobacterium tuberculosis H37Rv in complex with uridine diphosphate N-acetyl glucosamine | | Authors: | Lee, K.S., Park, J. | | Deposition date: | 2025-02-26 | | Release date: | 2025-08-26 | | Sequence: | >Entity 1
MMNHARGVENRSEGGGIDVVLVTGLSGAGRGTAAKVLEDLGWYVADNLPPQLITRMVDFGLAAGSRITQLAVVMDVRSRGFTGDLDSVRNELATRAITPRVVFMEASDDTLVRRYEQNRRSHPLQGEQTLAEGIAAERRMLAPVRATADLIIDTSTLSVGGLRDSIERAFGGDG
|
|
| PDBID: | 9m1x | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of human heart fatty acid-binding protein at 0.80 A resolution (holo-FABP3) | | Authors: | Sugiyama, S., Maekawa, S., Matsuoka, S., Murata, M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m22 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of human heart fatty acid-binding protein delipidated with Lipidex | | Authors: | Sugiyama, S., Maekawa, S., Matsuoka, S., Murata, M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1y | | Status: | HPUB -- hold until publication | | Title: | NMR Structure of Mouse Keratin 17 Tail Domain (G390 - R433) in solution | | Authors: | Yeom, J., Lee, C.H., Kim, J.H. | | Deposition date: | 2025-02-26 | | Sequence: | >Entity 1
GSTGEDAHLTQYKPKEPVTTRQVRTIVEEVQDGKVISSREQVHQTTR
|
|
| PDBID: | 9m1j | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the TBC-DE-Arl2-beta-tubulin complex | | Authors: | Seong, Y.J., Kim, H.M., Byun, K.M., Park, Y.W., Roh, S.H. | | Deposition date: | 2025-02-26 |
|
