| PDBID: | 9njs | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9nje | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9njq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9njd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9njl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9nj9 | | Status: | HPUB -- hold until publication | | Title: | Computationally optimized broadly reactive influenza B hemagglutinin BC2 bound by antibodies #46 and #3978 | | Authors: | Dzimianski, J.V., Kunkel, I., Balasco Serrao, V.H., DuBois, R.M. | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9nja | | Status: | HPUB -- hold until publication | | Title: | Computationally optimized broadly reactive influenza B hemagglutinin BC2 bound by antibody #46 | | Authors: | Dzimianski, J.V., Kunkel, I., Balasco Serrao, V.H., DuBois, R.M. | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9njg | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9njn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9njm | | Status: | HPUB -- hold until publication | | Title: | hMCT1-BSGiso2-INX444 | | Authors: | Lo, Y.-H., Dorsey, F.C. | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9njp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9q9h | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9i | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9j | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9l | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9p | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-26 | | Release date: | 2026-02-26 |
|
| PDBID: | 9q9n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9q | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-26 | | Release date: | 2026-02-26 |
|
| PDBID: | 9q9o | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-26 | | Release date: | 2026-02-26 |
|
| PDBID: | 9q9u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9t | | Status: | HPUB -- hold until publication | | Title: | Human ROCK2 in complex with a dihydropyrazolo-pyrimidine inhibitor | | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | | Deposition date: | 2025-02-26 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 9q9a | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
