| PDBID: | 9qwd | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of furin (PCSK3) in complex with the biphenyl-derived compound mi2470 | | Authors: | Dahms, S.O., Brandstetter, H. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qwe | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qwf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qwg | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qwh | | Status: | HPUB -- hold until publication | | Title: | G7P7 Fab in complex with the VP1 pentamer of BK polyomavirus genotype II | | Authors: | Pedenko, B., Schoehn, G., Effantin, G., Poignard, P. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qwm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qwa | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qwn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-14 | | Release date: | 2026-04-14 |
|
| PDBID: | 9qw3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepIII-HepII-HepI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qw2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepII-HepI-PhosI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qw4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic PhosII-HepII-HepI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qwl | | Status: | HPUB -- hold until publication | | Title: | Hemolysin-coregulated-protein-1 (Hcp1) from Bacteroides fragilis strain NCTC9343 | | Authors: | Sauer, U.H., Cisneros, D.A. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
(MSE)AFRATLSFAGKEFDVLDCTYSLKRDVDSKGRPSSNIYGGQIRLHVESTDDTSILEN(MSE)TNQFKPHSGSIVFKKGDEEAK(MSE)KELTWENGYITEFTENIDIVGSQP(MSE)TITFVVSAQVIKIGGAQFEQNWPKASGGGHHHHHH
|
|
| PDBID: | 9qw8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qw5 | | Status: | HPUB -- hold until publication | | Title: | Urate Oxidase from Aspergillus Flavus with its Inhibitor 9-Methyl Uric Acid by continuous serial electron diffraction (SerialED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qw6 | | Status: | HPUB -- hold until publication | | Title: | Urate Oxidase from Aspergillus Flavus with its Substrate Uric Acid by continuous serial electron diffraction (SerialED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o6y | | Status: | HPUB -- hold until publication | | Title: | Recombinant AD PHF complexed with SW-MK-NBD | | Authors: | Kunach, P., Diamond, M.I. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o6z | | Status: | HPUB -- hold until publication | | Title: | Recombinant AD THF with SW-MK-NBD complexed in AD-related Binding Site | | Authors: | Kunach, P., Diamond, M.I. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o76 | | Status: | HPUB -- hold until publication | | Title: | Recombinant AD THF complexed with SW-MK-NBD (Secondary Binding Site) | | Authors: | Kunach, P., Diamond, M.I. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o6x | | Status: | HPUB -- hold until publication | | Title: | Recombinant AD THF incubated with SW-MK-NBD (Non-Symmetric Binding) | | Authors: | Kunach, P., Diamond, M.I. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o6w | | Status: | HPUB -- hold until publication | | Title: | Recombinant AD PHF complexed with SW-MK-NBD (Non Symmetric Binding Site) | | Authors: | Kunach, P., Diamond, M.I. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o6v | | Status: | HPUB -- hold until publication | | Title: | Recombinant AD PHF complexed with SW-MK-NBD (PHF2) | | Authors: | Kunach, P., Diamond, M.I. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o6u | | Status: | HPUB -- hold until publication | | Title: | Recombinant AD PHF incubated with DMSO (Flat Backbone E342) | | Authors: | Kunach, P., Diamond, M.I., Rosa-Neto, P. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o79 | | Status: | HPUB -- hold until publication | | Title: | Recombinant AD PHF incubated with DMSO (Kinked Backbone E342) | | Authors: | Kunach, P., Diamond, M.I. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o7b | | Status: | HPUB -- hold until publication | | Title: | Recombinant AD THF incubated with DMSO (Kinked Backbone E342) | | Authors: | Kunach, P., Diamond, M.I. | | Deposition date: | 2025-04-14 |
|
