| PDBID: | 9r1j | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9r1k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9r1l | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9r1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9r1n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9r1o | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odt | | Status: | HPUB -- hold until publication | | Title: | The structure of a Bacterial Cyanide Dihydratase from Bacillus safensis PER-URP-08 | | Authors: | Justo Arevalo, S., Valle-Riestra F, V., Balan, A., Chuck, C.S. | | Deposition date: | 2025-04-27 | | Sequence: | >Entity 1
MTSIYPKFRAAAVQAAPVYLNLEATVEKSCELIDEAASNGAKLVAFPEAFLPGYPWFAFIGHPEYTRKFYHELYKNAVEIPSLAIQKISEAAKRNETYVCISCSEKDGGSLYLAQLWFNPNGDLIGKHRKMRASVAERLIWGDGSGSMMPVFQTDIGNLGGLMCWEHQVPLDLMAMNAQNEQVHVASWPGYFDDEISSRYYAIATQTFVLMTSSIYTEEMKEMICLTQEQRDYFETFKSGHTCIYGPDGEPISDMVPAETEGIAYAEIDVERVIDYKYYIDPAGHYSNQSLSMNFNQQPTPVVKQLYHQKNEVFTYEDIQYQHGILEEKV
|
|
| PDBID: | 9odd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Pasteurella multocida surface lipoprotein PmSLP-3 in complex with bovine complement component C4c and factor I | | Authors: | Nguyen, Q.H., Moraes, T.F. | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odc | | Status: | HPUB -- hold until publication | | Title: | Pasteurella multocida surface lipoprotein PmSLP-3 in complex with bovine complement component C3c and factor I | | Authors: | Nguyen, Q.H., Moraes, T.F. | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odg | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odi | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odj | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odo | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9ode | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9uop | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-26 |
|
| PDBID: | 9uoq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-26 |
|
