| PDBID: | 9oev | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9oew | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9ofa | | Status: | HPUB -- hold until publication | | Title: | The structure of a Fungal Cyanide Hydratase from Gloeocercospora sorghi | | Authors: | Justo Arevalo, S., Valle-Riestra F, V., Balan, A., Farah, C.S. | | Deposition date: | 2025-04-29 | | Sequence: | >Entity 1
MPINKYKAAVVTSEPVWENLEGGVVKTIEFINEAGKAGCKLIAFPEVWIPGYPYWMWKVNYLQSLPMLKAYRENSIAMDSSEMRRIRAAARDNQIYVSIGVSEIDHATLYLTQVLISPLGDVINHRRKIKPTHVEKLVYGDGSGDSFEPVTQTEIGRLGQLNCWENMNPFLKSLAVARGEQIHVAAWPVYPDLSKQVHPDPATNYADPASDLVTPAYAIETGTWVLAPFQRISVEGLKRHTPPGVEPETDATPYNGHARIFRPDGSLYAKPAVDFDGLMYVDIDLNESHLTKALADFAGHYMRPDLIRLLVDTRRKELVTEVGGGDNGGIQSYSTMARLGLDRPLEEEDYRQGTDAGETEKASSNGHA
|
|
| PDBID: | 9oen | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9oeo | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9ofk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | ABCC6 Apo Structure in GDN | | Authors: | Reddy, B.G. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9off | | Status: | HPUB -- hold until publication | | Title: | human prostamide/prostaglandin F synthase C44SC47S mutant, P212121 crystal form | | Authors: | Nguyen, T.K.Y., Han, B.W. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9ofi | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9ofm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9ofl | | Status: | HPUB -- hold until publication | | Title: | ABCC6 Bound to RTY-14745 Structure in GDN | | Authors: | Reddy, B.G. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9oe1 | | Status: | HPUB -- hold until publication | | Title: | Zebrafish Abcb4 in IF-narrow conformation in the presence of Tariquidar (TQR-IF-Narrow) | | Authors: | Zhan, J., Xia, D. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oe2 | | Status: | HPUB -- hold until publication | | Title: | Zebrafish Abcb4 in IF-medium conformation in the presence of Tariquidar (TQR-IF-Medium) | | Authors: | Zhan, J., Xia, D. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oe3 | | Status: | HPUB -- hold until publication | | Title: | Zebrafish Abcb4 in IF-Wide conformation in the presence of Tariquidar (TQR-IF-Wide) | | Authors: | Zhan, J., Xia, D. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oe7 | | Status: | HPUB -- hold until publication | | Title: | Zebrafish Abcb4 in IF-narrow conformation in the presence of Vincristine (VCR-IF-Narrow) | | Authors: | Zhan, J., Xia, D. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oe8 | | Status: | HPUB -- hold until publication | | Title: | Zebrafish Abcb4 in IF-medium conformation in the presence of Vincristine (VCR-IF-Medium) | | Authors: | Zhan, J., Xia, D. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oe9 | | Status: | HPUB -- hold until publication | | Title: | Zebrafish Abcb4 in IF-Wide conformation in the presence of Vincristine (VCR-IF-Wide) | | Authors: | Zhan, J., Xia, D. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9ody | | Status: | HPUB -- hold until publication | | Title: | Zebrafish Abcb4 in IF-narrow conformation (IF-Narrow) | | Authors: | Zhan, J., Xia, D. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9odz | | Status: | HPUB -- hold until publication | | Title: | Zebrafish Abcb4 in IF-Wide conformation (IF-Wide) | | Authors: | Zhan, J., Xia, D. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oec | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oea | | Status: | HPUB -- hold until publication | | Title: | SIPV1-5E12 Complex | | Authors: | Waddey, B.T., Hafenstein, S.L. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oed | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oeg | | Status: | HPUB -- hold until publication | | Title: | Structure of the human astrovirus VA1 capsid spike bound to antibody 2A2 | | Authors: | Ghosh, A., Dzimianski, J.V., Balasco Serrao, V.H., DuBois, R.M. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oem | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-28 | | Release date: | 2026-04-28 |
|
| PDBID: | 9upk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9upj | | Status: | HPUB -- hold until publication | | Title: | Entamoeba histolytica Cyclophilin 18 in complex with Voclosporin | | Authors: | Gandhi, S., Vasudevan, D. | | Deposition date: | 2025-04-28 |
|
