| PDBID: | 9uwt | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human galectin-10 produced by cell-free protein synthesis in complex with maltose | | Authors: | Kojima, M., Ueno, T., Abe, S., Hirata, K. | | Deposition date: | 2025-05-12 | | Release date: | 2026-05-12 |
|
| PDBID: | 9uwu | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human galectin-10 produced by cell-free protein synthesis in complex with melezitose | | Authors: | Kojima, M., Ueno, T., Abe, S., Hirata, K. | | Deposition date: | 2025-05-12 | | Release date: | 2026-05-12 |
|
| PDBID: | 9uw5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9uwk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human galectin-10 produced by cell-free protein synthesis | | Authors: | Kojima, M., Ueno, T., Abe, S., Hirata, K. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9uwl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9r6e | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9r6i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPARgamma in complex with the bisphenol derivative BPS4BE | | Authors: | Carivenc, C., Bourguet, W. | | Deposition date: | 2025-05-12 | | Sequence: | >Entity 1
GSHMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
| PDBID: | 9r6g | | Status: | HPUB -- hold until publication | | Title: | Map of neurofibromin homodimer lobe region. Post-processed by DeepEMhancer using combined half maps. | | Authors: | Shutian, S. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9r6h | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9r6k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPARgamma in complex with the bisphenol derivative BPPH | | Authors: | Carivenc, C., Bourguet, W. | | Deposition date: | 2025-05-12 | | Sequence: | >Entity 1
GSHMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
| PDBID: | 9r6f | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9r6j | | Status: | HPUB -- hold until publication | | Title: | Map of neurofibromin homotetramer with D2 symmetry (DeepEMhancer) | | Authors: | Shutian, S. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9olg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HIV-1 protease with elunonavir (GS-1156) | | Authors: | Lansdon, E.B. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9olh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9ol9 | | Status: | HPUB -- hold until publication | | Title: | Backbone-modified parallel beta hairpin (PBH): N-alpha-amino Phenylalanine at position 4 | | Authors: | Starnes, S.K., Horne, W.S., Del Valle, J.R. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9ola | | Status: | HPUB -- hold until publication | | Title: | Backbone-modified parallel beta hairpin (PBH): N-alpha-amino Tyrosine at position 15 | | Authors: | Starnes, S.K., Horne, W.S., Del Valle, J.R. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9ol4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9oll | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9olm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9olf | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-05-12 | | Release date: | 2026-05-12 |
|
| PDBID: | 9ole | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9ol5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9ol6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9old | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of alpha-NPG-bound D59C MelBSt | | Authors: | Guan, L., Hariharan, P. | | Deposition date: | 2025-05-12 | | Sequence: | >Entity 1
SISMTTKLSYGFGAFGKDFAIGIVYMYLMYYYTDVVGLSVGLVGTLFLVARIWDAINCPIMGWIVNATRSRWGKFKPWILIGTLTNSLVLFLLFSAHLFEGTAQVVFVCVTYILWGMTYTIMDIPFWSLVPTITLDKREREQLVPFPRFFASLAGFVTAGITLPFVSYVGGADRGFGFQMFTLVLIAFFIASTIVTLRNVHEVYSSDNGVTAGRPHLTLKTIVGLIYKNDQLSCLLGMALAYNIASNIINGFAIYYFTYVIGDADLFPYYLSYAGAANLLTLIVFPRLVKMLSRRILWAGASVMPVLSCAGLFAMALADIHNAALIVAAGIFLNIGTALFWVLQVIMVADTVDYGEFKLNIRCESIAYSVQTMVVKGGSAFAAFFIALVLGLIGYTPNVAQSAQTLQGMQFIMIVLPVLFFMMTLVLYFRYYRLNGDMLRKIQIHLLDKYRKTPPFVEQPDSPAISVVATSDVKAHHHHHHHHHH
|
|
| PDBID: | 9olc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPARg ligand-binding domain in complex with NCoR1 peptide and FTX-6746 | | Authors: | Setser, J.W., DeLaBarre, B. | | Deposition date: | 2025-05-12 |
|
