| PDBID: | 9ux4 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of the human P2X3 receptor in the camlipixant-bound inhibited state | | Authors: | Zhang, J., Cheng, X.Y. | | Deposition date: | 2025-05-13 | | Release date: | 2026-05-13 |
|
| PDBID: | 9uww | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of the human P2X2 receptor in the apo closed state | | Authors: | Zhang, J., Cheng, X.Y. | | Deposition date: | 2025-05-13 | | Release date: | 2026-05-13 |
|
| PDBID: | 9uwx | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of the human P2X2 receptor in the ATP-bound open state | | Authors: | Zhang, J., Cheng, X.Y. | | Deposition date: | 2025-05-13 | | Release date: | 2026-05-13 |
|
| PDBID: | 9r6s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6t | | Status: | HPUB -- hold until publication | | Title: | Prefusion stabilized spike glycoprotein of equine coronavirus. | | Authors: | Melchers, J.M., Hulswit, R.J.G., Hurdiss, D.L. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6z | | Status: | HPUB -- hold until publication | | Title: | Cubic state of the F420-reducing hydrogenase from Methanothermococcus thermolithotrophicus | | Authors: | Jespersen, M., Lemaire, O.N., Wagner, T. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6w | | Status: | HPUB -- hold until publication | | Title: | CHAP domain of Pneumococcal Endopeptidase PcsB | | Authors: | Briggs, N.S., Roper, D.I. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r71 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli Adenylate kinase E114A mutant in complex with inhibitor Ap5a. | | Authors: | Mattsson, J., Rogne, P., Wolf-Watz, M., Sauer-Eriksson, A.E. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r72 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Odinarchaeota Adenylate kinase (OdinAK) S74G mutant | | Authors: | Rodriguez Buitrago, J.A., Schierholz, L., Mattsson, J., Wolf-Watz, M., Sauer-Eriksson, A.E. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of C14S mutant of triosephosphate isomerase from Chamydomonas reinhardtii | | Authors: | Fermani, S., Fanti, S., Gabellini, G., Zaffagnini, M., Meloni, M., Peppi, G.M.E. | | Deposition date: | 2025-05-13 | | Sequence: | >Entity 1
ASSAKFFVGGNWKSNGSVANVAKLVDELNAGTIPRGVDVVVAPPFIYIDYVMQHLDRDKYQLSAQNAWIGGNGAFTGEVSAEQLTDFGVPWVILGHSERRSLFGESNEVVAKKTSHALAAGLGVIACIGETLEQRNSGSVFKVLDAQMDALVDEVKDWTKVVLAYEPVWAIGTGVVASPEQAQEVHAYLRQYCAKKLGAAVADKLRIIYGGSVSDTNCKDLSKQEDIDGFLVGGASLKGAAFVTICNAAGPKAKP
|
|
| PDBID: | 9r6v | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6x | | Status: | HPUB -- hold until publication | | Title: | Map of neurofibromin homotetramer with D2 symmetry. | | Authors: | Shutian, S. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r75 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6l | | Status: | HPUB -- hold until publication | | Title: | Map of neurofibromin homotetramer. | | Authors: | Shutian, S. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9omd | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9om5 | | Status: | HPUB -- hold until publication | | Title: | Composite map of six VRC35 Fabs and three MEDI8852 Fabs bound to influenza H3N2 Victoria 2011 hemagglutinin | | Authors: | Cheng, J., Cale, E.M., Longo, N., Sutton, M.S., Lei, H., Huang, R., Morton, A.J., Lang, Z.C., Morano, N.C., Roark, R.S., Becker, J.E., Tsybovsky, Y., Li, N., Zhang, B., Du, H., Rubin, S., Shapiro, L., Pierson, T.C., Doria-Rose, N.A., Kwong, P.D., Zhou, T. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9om1 | | Status: | HPUB -- hold until publication | | Title: | Full length LRRK2 active form 1 (class6) | | Authors: | Villagran-Suarez, A.C. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9om2 | | Status: | HPUB -- hold until publication | | Title: | Full-length LRRK2 autoinhibited | | Authors: | Villagran-Suarez, A.C. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9om0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9om3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9olv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9olx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9omb | | Status: | HPUB -- hold until publication | | Title: | NRDJ-1 Intein NMR solution structure | | Authors: | Parveen, N., Ye, X., Cahill, S., Muir, T.W., Cowburn, D. | | Deposition date: | 2025-05-13 |
|
