| PDBID: | 9r6w | | Status: | HPUB -- hold until publication | | Title: | CHAP domain of Pneumococcal Endopeptidase PcsB | | Authors: | Briggs, N.S., Roper, D.I. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r72 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Odinarchaeota Adenylate kinase (OdinAK) S74G mutant | | Authors: | Rodriguez Buitrago, J.A., Schierholz, L., Mattsson, J., Wolf-Watz, M., Sauer-Eriksson, A.E. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of C14S mutant of triosephosphate isomerase from Chamydomonas reinhardtii | | Authors: | Fermani, S., Fanti, S., Gabellini, G., Zaffagnini, M., Meloni, M., Peppi, G.M.E. | | Deposition date: | 2025-05-13 | | Sequence: | >Entity 1
ASSAKFFVGGNWKSNGSVANVAKLVDELNAGTIPRGVDVVVAPPFIYIDYVMQHLDRDKYQLSAQNAWIGGNGAFTGEVSAEQLTDFGVPWVILGHSERRSLFGESNEVVAKKTSHALAAGLGVIACIGETLEQRNSGSVFKVLDAQMDALVDEVKDWTKVVLAYEPVWAIGTGVVASPEQAQEVHAYLRQYCAKKLGAAVADKLRIIYGGSVSDTNCKDLSKQEDIDGFLVGGASLKGAAFVTICNAAGPKAKP
|
|
| PDBID: | 9r6v | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6x | | Status: | HPUB -- hold until publication | | Title: | Map of neurofibromin homotetramer with D2 symmetry. | | Authors: | Shutian, S. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r75 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r71 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli Adenylate kinase E114A mutant in complex with inhibitor Ap5a. | | Authors: | Mattsson, J., Rogne, P., Wolf-Watz, M., Sauer-Eriksson, A.E. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9olg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HIV-1 protease with elunonavir (GS-1156) | | Authors: | Lansdon, E.B. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9olh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9ol7 | | Status: | HPUB -- hold until publication | | Title: | Backbone-modified parallel beta hairpin (PBH): wild-type | | Authors: | Starnes, S.K., Horne, W.S., Del Valle, J.R. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9olk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9ol8 | | Status: | HPUB -- hold until publication | | Title: | Backbone-modified parallel beta hairpin (PBH): N-alpha-amino Arginine at position 17 | | Authors: | Starnes, S.K., Horne, W.S., Del Valle, J.R. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9ol9 | | Status: | HPUB -- hold until publication | | Title: | Backbone-modified parallel beta hairpin (PBH): N-alpha-amino Phenylalanine at position 4 | | Authors: | Starnes, S.K., Horne, W.S., Del Valle, J.R. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9ola | | Status: | HPUB -- hold until publication | | Title: | Backbone-modified parallel beta hairpin (PBH): N-alpha-amino Tyrosine at position 15 | | Authors: | Starnes, S.K., Horne, W.S., Del Valle, J.R. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9ol4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9oll | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9olm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9olf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-12 | | Release date: | 2026-05-12 |
|
| PDBID: | 9ole | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9ol5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9ol6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9old | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of alpha-NPG-bound D59C MelBSt | | Authors: | Guan, L., Hariharan, P. | | Deposition date: | 2025-05-12 | | Sequence: | >Entity 1
SISMTTKLSYGFGAFGKDFAIGIVYMYLMYYYTDVVGLSVGLVGTLFLVARIWDAINCPIMGWIVNATRSRWGKFKPWILIGTLTNSLVLFLLFSAHLFEGTAQVVFVCVTYILWGMTYTIMDIPFWSLVPTITLDKREREQLVPFPRFFASLAGFVTAGITLPFVSYVGGADRGFGFQMFTLVLIAFFIASTIVTLRNVHEVYSSDNGVTAGRPHLTLKTIVGLIYKNDQLSCLLGMALAYNIASNIINGFAIYYFTYVIGDADLFPYYLSYAGAANLLTLIVFPRLVKMLSRRILWAGASVMPVLSCAGLFAMALADIHNAALIVAAGIFLNIGTALFWVLQVIMVADTVDYGEFKLNIRCESIAYSVQTMVVKGGSAFAAFFIALVLGLIGYTPNVAQSAQTLQGMQFIMIVLPVLFFMMTLVLYFRYYRLNGDMLRKIQIHLLDKYRKTPPFVEQPDSPAISVVATSDVKAHHHHHHHHHH
|
|
| PDBID: | 9olc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPARg ligand-binding domain in complex with NCoR1 peptide and FTX-6746 | | Authors: | Setser, J.W., DeLaBarre, B. | | Deposition date: | 2025-05-12 |
|
