| PDBID: | 9rd0 | | Status: | HPUB -- hold until publication | | Title: | Structure of DabA2B2 complex solved under ambient condition | | Authors: | Lo, Y.K., Bohn, S., Schuller, J. | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9rcx | | Status: | HPUB -- hold until publication | | Title: | Structure of protein kinase CK2alpha mutant T127M associated with the Okur-Chung Neurodevelopmental Syndrome | | Authors: | Werner, C., Gast, A., Jose, J., Niefind, K. | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9rcy | | Status: | HPUB -- hold until publication | | Title: | Structure of protein kinase CK2alpha mutant R21Q associated with the Okur-Chung Neurodevelopmental Syndrome | | Authors: | Werner, C., Gast, A., Jose, J., Niefind, K. | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9rcw | | Status: | HPUB -- hold until publication | | Title: | Primed-state RyR1 in 0.01% POPC micelles, in complex with a nanobody and FKBP12 | | Authors: | Li, C., Efremov, R.G. | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9ous | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | D3 Virion icos | | Authors: | Belford, A.K., Huet, A., Maurer, J.B., Duda, R.L., Conway, J.F. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9oum | | Status: | HPUB -- hold until publication | | Title: | Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in complex with GABA and PZ-II-029 | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ouo | | Status: | HPUB -- hold until publication | | Title: | Native GABA-A receptor from rat cerebella, beta1-alpha1-beta1-alpha1-gamma2 subtype, in complex with GABA and PZ-II-029 | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9oun | | Status: | HPUB -- hold until publication | | Title: | Native GABA-A receptor from rat cerebella, beta2-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA and PZ-II-029 | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov4 | | Status: | HPUB -- hold until publication | | Title: | Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA and PZ-II-029 | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ouv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human IGG1 FC fragment-FC-gamma receptor IIB complex | | Authors: | Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ouz | | Status: | HPUB -- hold until publication | | Title: | Icosahedral D3 expanded capsid | | Authors: | Belford, A.K., Huet, A., Maurer, J.B., Duda, R.L., Conway, J.F. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human IGA2M1 FC fragment-FC-alpha receptor (CD89) complex | | Authors: | Chandravanshi, M., Korzeniowski, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ovb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ovc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ovd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ove | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ovf | | Status: | HPUB -- hold until publication | | Title: | Rubredoxin covalently linked to benzo-18-crown-6 | | Authors: | Adhami, N., Sawaya, M.R., Shafaat, H.S., Rodriguez, J.A., Spokoyny, A.M. | | Deposition date: | 2025-05-29 | | Sequence: | >Entity 1
MQKYVCNVCGYEYDPAEHDNVPFDQLPDDWCCPVCGVSKDQFSPA
|
|
| PDBID: | 9ova | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PKD2 ion channel, P658A mutant | | Authors: | Esarte Palomero, O., DeCaen, P.G. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9oup | | Status: | HPUB -- hold until publication | | Title: | Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in complex with GABA | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
