| PDBID: | 9jpe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpg | | Status: | HPUB -- hold until publication | | Title: | crRNA-guided surveillance (Csy) complex | | Authors: | Wang, W.H., Guan, L.L., Du, X.Y., Feng, Y. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jph | | Status: | HPUB -- hold until publication | | Title: | crRNA-guided surveillance (Csy) complex | | Authors: | Wang, W.H., Guan, L.L., Du, X.Y., Feng, Y. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpv | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-09-26 | | Release date: | 2025-09-26 |
|
| PDBID: | 9jpx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9dsa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9drw | | Status: | HPUB -- hold until publication | | Title: | Myocilin OLF mutant A427T | | Authors: | Scelsi, H.F., Lieberman, R.L. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
LKESPSGYLRSGEGDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVTNAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDIKLSKM
|
|
| PDBID: | 9drr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9drt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the complex of M. tuberculosis PheRS with cognate precursor tRNA and fragment DDD00805735 | | Authors: | Chang, C., Michalska, K., Forte, B., Baragana, B., Gilbert, I.H., Wower, J., Joachimiak, A., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9dsb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Spermin/spermidine N-Acetyltransferase from Enterococcus faecalis V583 | | Authors: | Kim, Y., Maltseva, N., Endres, M., Kuhn, M., Joachimiak, A., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Apo-241_2F04 Fab | | Authors: | Lin, T.H., Wilson, I.A. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gvp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9gvs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9gvu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9gvt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9gvr | | Status: | HPUB -- hold until publication | | Title: | mEos4b-L93M photoconvertible fluorescent protein | | Authors: | Adam, V. | | Deposition date: | 2024-09-25 |
|
