| PDBID: | 8k7s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-27 | | Release date: | 2025-01-27 |
|
| PDBID: | 8k7w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-27 | | Release date: | 2025-01-27 |
|
| PDBID: | 8k85 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2023-07-28 |
|
| PDBID: | 8k9c | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-31 | | Release date: | 2025-01-31 |
|
| PDBID: | 8k9d | | Status: | HOLD -- hold until a certain date | | Title: | Structure of human Caprin-2 HR1 domain | | Authors: | Song, X.M. | | Deposition date: | 2023-07-31 | | Release date: | 2025-01-31 |
|
| PDBID: | 8kbc | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbg | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbh | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbj | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbs | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kc9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-06 |
|
| PDBID: | 8kcj | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N7 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8kck | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N9 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-07 | | Sequence: | >Entity 1
GAEAAAAAAVTAELRAFRAAGGTVELEDLPVTPETLARAEAALARLPPESVAVETYTVPAPTPEAFLAALEAALARLAAEGLPAILLRVVDADGNLVGSILVAAAGPPAESAAATGRVLTIYVASSPEGLKVARGLAIETRDAGGLALAIGASGAWALAGLAGALALARRLAEAHGAPVRVVTIGDPANPTDAALAAAIRAAYAAALEHHHHHH
|
|
| PDBID: | 8kco | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8kcp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8kcr | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of E447A Acyl-CoA Dehydrogenase FadE15 mutant from Mycobacteria tuberculosis in complex with C18CoA | | Authors: | Liu, X., Chen, R., Ma, M. | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8kcs | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human gamma-secretase in complex with BMS906024 | | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8kct | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human gamma-secretase in complex with Nirogacestat | | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | | Deposition date: | 2023-08-08 |
|
