PDBID: | 9b95 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the closed NF449-bound human P2X1 receptor | Authors: | Felix, M.B., Alisa, G., Hariprasad, V., Jesse, I.M., David, M.T. | Deposition date: | 2024-04-01 |
|
PDBID: | 9b96 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-01 |
|
PDBID: | 9b97 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-01 |
|
PDBID: | 9b98 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-01 |
|
PDBID: | 9b99 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-01 |
|
PDBID: | 9b9a | Status: | HOLD -- hold until a certain date | Title: | SF-Tau in dominantly inherited Alzheimer disease | Authors: | Hoq, M.R., Vago, F.S., Bharath, S.R., Jiang, W. | Deposition date: | 2024-04-01 | Release date: | 2025-04-01 |
|
PDBID: | 9b9b | Status: | HPUB -- hold until publication | Title: | PHF Tau in dominantly inherited Alzheimer disease | Authors: | Hoq, M.R., Vago, F.S., Bharath, S.R., Jiang, W. | Deposition date: | 2024-04-01 |
|
PDBID: | 9b9c | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-04-01 | Release date: | 2025-04-01 |
|
PDBID: | 9b9d | Status: | AUTH -- processed, waiting for author review and approval | Title: | Type Id beta-amyloid 42 Filaments from dominantly inherited Alzheimer disease brain | Authors: | Hoq, M.R., Vago, F.S., Bharath, S.R., Jiang, W. | Deposition date: | 2024-04-01 | Release date: | 2025-04-01 |
|
PDBID: | 9b9e | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-01 |
|
PDBID: | 9b9f | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-02 |
|
PDBID: | 9b9g | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-04-02 |
|
PDBID: | 9b9h | Status: | HPUB -- hold until publication | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40333 | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | Deposition date: | 2024-04-02 |
|
PDBID: | 9b9i | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-02 |
|
PDBID: | 9b9j | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-02 |
|
PDBID: | 9b9k | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-02 |
|
PDBID: | 9b9l | Status: | HPUB -- hold until publication | Title: | RPRD1B C-terminal interacting domain bound to a pThr4 CTD peptide | Authors: | Moreno, R.Y., Zhang, Y.J. | Deposition date: | 2024-04-02 |
|
PDBID: | 9b9m | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-02 |
|
PDBID: | 9b9n | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-02 |
|
PDBID: | 9b9o | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-02 |
|
PDBID: | 9b9p | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 | Sequence: | >Entity 1 MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQDASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEKHHHHHH
|
|
PDBID: | 9b9q | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9r | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9s | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9t | Status: | HPUB -- hold until publication | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40407 | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | Deposition date: | 2024-04-03 |
|