PDBID: | 9b9d | Status: | AUTH -- processed, waiting for author review and approval | Title: | Type Id beta-amyloid 42 Filaments from dominantly inherited Alzheimer disease brain | Authors: | Hoq, M.R., Vago, F.S., Bharath, S.R., Jiang, W. | Deposition date: | 2024-04-01 | Release date: | 2025-04-01 |
|
PDBID: | 9b9e | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-01 |
|
PDBID: | 9b9f | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-02 |
|
PDBID: | 9b9g | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-02 |
|
PDBID: | 9b9h | Status: | HPUB -- hold until publication | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40333 | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | Deposition date: | 2024-04-02 |
|
PDBID: | 9b9i | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-02 |
|
PDBID: | 9b9j | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-02 |
|
PDBID: | 9b9k | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-02 |
|
PDBID: | 9b9p | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 | Sequence: | >Entity 1 MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQDASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEKHHHHHH
|
|
PDBID: | 9b9q | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9s | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9t | Status: | HPUB -- hold until publication | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40407 | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9u | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | SARS CoV-2 full-length spike protein with His1271Lys substitution in the coatomer binding motif, 1RBD-up conformation | Authors: | Singh, S., Hasan, S.S. | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9w | Status: | HPUB -- hold until publication | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40792 | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9x | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9y | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9z | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba2 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the binary complex of DCAF1 and WDR5 | Authors: | Mabanglo, M.F., Vedadi, M., Al-awar, R. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba6 | Status: | HPUB -- hold until publication | Title: | High-resolution crystal structure of Vibrio cholerae NFeoB in the apo form | Authors: | Lee, M., Smith, A.T. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Vibrio cholerae N150T NFeoB variant with a single GDP molecule bound | Authors: | Lee, M., Smith, A.T. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | Authors: | Hendle, J. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | Authors: | Hendle, J. | Deposition date: | 2024-04-03 |
|