| PDBID: | 8ub8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ub9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8uba | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ubb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ubc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ubd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ube | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ubf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ubi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8ubj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8ubk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8ubl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8ubm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8ubn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8ubo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8ubp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8ubq | | Status: | HPUB -- hold until publication | | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and 2-benzyl-4-phenylthiazole-5-carboxylic acid | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-24 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8ubs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NrdJ-1 split intein fusion | | Authors: | Kofoed, C., Ye, X., Jeffrey, P.D., Muir, T.W. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8ubt | | Status: | HPUB -- hold until publication | | Title: | Structure of SCF-FBXL17-BACH1BTB E3 ligase complex | | Authors: | Shi, H., Cao, S. | | Deposition date: | 2023-09-24 | | Release date: | 2025-03-26 |
|
| PDBID: | 8ubv | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of dimeric FBXL17-BACH1BTB E3 ubiquitin ligase complex | | Authors: | Shi, H., Cao, S., Zheng, N. | | Deposition date: | 2023-09-25 | | Release date: | 2025-03-26 |
|
| PDBID: | 8uc5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8uca | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-26 | | Release date: | 2025-01-31 |
|
| PDBID: | 8ucj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 8uck | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 8ucl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
