| PDBID: | 8rnl | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with lauric acid | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnm | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with testosterone | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnn | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with prednisone | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rno | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with isophorone | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnp | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with R-limonene | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnq | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with dodecane | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnr | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with tetradecane | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rns | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase XII mimic in complex with biguanide derivative inhibitor 1-carbamimidamido-N-[(4 sulfamoylphenyl)methyl]methanimidamide | | Authors: | Baroni, C., Ferraroni, M. | | Deposition date: | 2024-01-10 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFKVNFDDSQDKAVLKGGPLDGTYRLTQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDASKASQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLNETVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8rnz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ro0 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ro1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the C. elegans Intron Lariat Spliceosome primed for disassembly (ILS'') | | Authors: | Vorlaender, M.K., Rothe, P., Plaschka, C. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ro2 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ro3 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Cryo-EM structure of the staked Photosystem II - LHCII supercomplex from Chlorella ohadi | | Authors: | Fadeeva, M., Klaiman, D., Caspy, I., Nelson, N. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ro4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ro5 | | Status: | HPUB -- hold until publication | | Title: | HLA-A3 restricted mG12V-TCR | | Authors: | Sim, M.J.W., Sun, P.D. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ro6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ro7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ro8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ro9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8roa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8rob | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8roc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8rod | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8roe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8rof | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
