| PDBID: | 8rg9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8rga | | Status: | HPUB -- hold until publication | | Title: | BmrA E504-25uMATPMg | | Authors: | Gobet, A., Zarkadas, E., Schoehn, G., Falson, P., Chaptal, V. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8rgb | | Status: | HPUB -- hold until publication | | Title: | High pH (8.0) nitrite-bound MSOX movie series dataset 5 of the copper nitrite reductase from Bradyrhizobium sp. ORS375 (two-domain)[5.60 MGy] | | Authors: | Rose, S.L., Ferroni, F.M., Antonyuk, S.V., Eady, R.R., Hasnain, S.S. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8rgc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8rgd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8rgf | | Status: | HPUB -- hold until publication | | Title: | Arginase 2 in complex with inhibitor | | Authors: | Petersen, J. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8rgj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8rgm | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of nucleosome containing Widom603 DNA | | Authors: | Motorin, N.A., Afonin, D., Armeev, G.A., Moiseenko, A., Zhao, L., Vasiliev, V., Oleinikov, P., Shaytan, A., Shi, X., Studitsky, V., Sokolova, O. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8rgn | | Status: | HPUB -- hold until publication | | Title: | BmrA E504-R6G-70uMATPMg | | Authors: | Gobet, A., Zarkadas, E., Schoehn, G., Falson, P., Chaptal, V. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8rgu | | Status: | HPUB -- hold until publication | | Title: | Arginase 2 in complex with inhibitor | | Authors: | Petersen, J. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8rgv | | Status: | HPUB -- hold until publication | | Title: | Myo-inositol-1-phosphate synthase from Thermochaetoides thermophila in complex with NAD | | Authors: | Traeger, T.K., Kyrilis, F.L., Hamdi, F., Kastritis, P.L. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8rgx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8rh4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8rh5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8rh7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rh8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rh9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rha | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhb | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Neisseria gonorrhoeae FabI in complex with NADH and (E)-3-((2R,3S)-3-hydroxy-2-methyl-4-oxo-2,3,4,5-tetrahydro-1H-pyrido[2,3-b][1,4]diazepin-8-yl)-N-methyl-N-((3-methylbenzofuran-2-yl)methyl)acrylamide | | Authors: | Ronin, C., Gerusz, V., Ciesielski, F. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhh | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 | | Sequence: | >Entity 1
GPGSRTPVELRLTEIFRDVLGHDAFGVLDDFFELGGDSFKAIRIAAKYGPPLEVTDIYDHPTIEALAAHLAR
|
|
| PDBID: | 8rho | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
