| PDBID: | 8r9t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8r9v | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the primed actomyosin-5a complex | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8rag | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rah | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8ral | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8ram | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8ran | | Status: | HPUB -- hold until publication | | Title: | Structure of Sen1-RNA complex | | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rao | | Status: | HPUB -- hold until publication | | Title: | Structure of Sen1-ADP.BeF3-RNA complex | | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rap | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Sen1-ADP.BeF3 bound RNA Polymerase II pre-termination complex | | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8raq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rar | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of chimeric human carbonic anhydrase IX with N-butyl-4-chloro-2-(cyclohexylsulfanyl)-5-sulfamoylbenzamide | | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | | Deposition date: | 2023-12-01 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8rau | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rav | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8raw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rax | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8ray | | Status: | HPUB -- hold until publication | | Title: | ParA in complex with ATP | | Authors: | Mais, C.-N., Bange, G. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8raz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rb0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rb1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rb2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rba | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbb | | Status: | HPUB -- hold until publication | | Title: | p53-Y220C Core Domain Covalently Bound to 2,5,6-trifluoropyridine-3-carbonitrile Soaked at 40 mM | | Authors: | Stahlecker, J., Klett, T., Stehle, T., Boeckler, F.M. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbc | | Status: | HPUB -- hold until publication | | Title: | p53-Y220C Core Domain Covalently Bound to 3-amino-5-chloropyrazine-2,6-dicarbonitrile Soaked at 5 mM | | Authors: | Stahlecker, J., Klett, T., Stehle, T., Boeckler, F.M. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbe | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
