| PDBID: | 8qy2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qy3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qy7 | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorD apo form | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qy8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2024-10-25 |
|
| PDBID: | 8qyc | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorD in complex with ATP-gamma-S | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qyd | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorAB | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qyh | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorAB ZorA E86A_E89A, Calcium binding site mutation | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qyk | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorAB, ZorA delta_359-592, ZorA tail middle deletion. | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qyv | | Status: | HOLD -- hold until a certain date | | Title: | SWR1-hexasome complex | | Authors: | Jalal, A.S.B., Wigley, D.B. | | Deposition date: | 2023-10-26 | | Release date: | 2024-10-26 |
|
| PDBID: | 8qyx | | Status: | HPUB -- hold until publication | | Title: | Human 60S ribosomal subunit | | Authors: | Wiechert, F., Schacherl, M., Sprink, T. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qyy | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorAB, ZorA delta_435-729, ZorA tail tip deletion. | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qyz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-26 | | Release date: | 2024-10-26 |
|
| PDBID: | 8qz0 | | Status: | HOLD -- hold until a certain date | | Title: | SWR1-hexasome-dimer complex | | Authors: | Jalal, A.S.B., Wigley, D.B. | | Deposition date: | 2023-10-26 | | Release date: | 2024-10-26 |
|
| PDBID: | 8qz5 | | Status: | HPUB -- hold until publication | | Title: | Alpha-1-antitrypsin (Tyr244Phe) in the native conformation | | Authors: | Aldobiyan, I., Lomas, D.A., Irving, J.A. | | Deposition date: | 2023-10-26 | | Sequence: | >Entity 1
MRGSHHHHHHTDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQH(OCS)KKLSSWVLLMKFLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
|
|
| PDBID: | 8qz6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qz7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qza | | Status: | HPUB -- hold until publication | | Title: | D-2-hydroxyacid dehydrogenase (D2-HDH) from Haloferax mediterranei apo-enzyme (2.25 A resolution) | | Authors: | Baker, P.J., Barrett, J.R., Dakhil, A.A.A.B., Domenech, J., Bisson, C., Pramanpol, N., Sedelnikova, S.E., Ferrer, J., Rice, D.W. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qzb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qzl | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo-EM co-structure of Klebsiella pneumoniae AcrB with the BDM91288 efflux pump inhibitor at 3.42 Angstrom resolution | | Authors: | Boernsen, C., Mueller, R.T., Pos, K.M., Frangakis, A.S. | | Deposition date: | 2023-10-27 |
|
| PDBID: | 8qzm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-27 |
|
| PDBID: | 8qzp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-28 |
|
| PDBID: | 8qzq | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo-EM co-structure of E. coli AcrB with bound BDM91531 inhibitor | | Authors: | Boernsen, C., Mueller, R.T., Pos, K.M., Frangakis, A.S. | | Deposition date: | 2023-10-29 |
|
| PDBID: | 8qzt | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo-EM co-structure of E. coli AcrB with bound BDM91531 inhibitor at 3.52 A resolution | | Authors: | Boernsen, C., Mueller, R.T., Pos, K.M., Frangakis, A.S. | | Deposition date: | 2023-10-29 |
|
| PDBID: | 8qzu | | Status: | HPUB -- hold until publication | | Title: | XhpG hydrolase mutant S98A of Xenorhabdus hominickii | | Authors: | Calderari, A., Gruez, A., Weissman, K.J. | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8qzy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 |
|
