| PDBID: | 8rbf | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the post-powerstroke actomyosin-5a complex | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbg | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of primed myosin-5a (ADP-Pi state) | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of chimeric human carbonic anhydrase IX with 4-chloro-2-(cyclohexylsulfanyl)-N-(2-hydroxyethyl)-5-sulfamoylbenzamide | | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | | Deposition date: | 2023-12-04 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8rbw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8rby | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of the SARS-CoV-2 receptor binding domain in complex with the neutralizing nanobody 1.26 | | Authors: | Casasnovas, J.M., Fernandez, L.A., Silva, K. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8rc2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8rc3 | | Status: | HPUB -- hold until publication | | Title: | DNA bound type IV-A1 CRISPR effector complex from P. oleovorans | | Authors: | Miksys, A., Cepaite, R., Malinauskaite, L., Pausch, P. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8rc5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8rce | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPAR alfa Ligand Binding Domain in complex with the ligand LBB78 | | Authors: | Capelli, D., Montanari, R. | | Deposition date: | 2023-12-06 | | Sequence: | >Entity 1
HHHHHHSSGLVPRGSHTADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
|
|
| PDBID: | 8rci | | Status: | HPUB -- hold until publication | | Title: | Human p53 DNA-binding domain bound to DARPin C10 | | Authors: | Balourdas, D.I., Muenick, P., Strubel, A., Knapp, S., Dotsch, V., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8rcr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rcu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rcx | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of the Mycobacterium tuberculosis regulator VirS (N-terminal fragment 4-208) in complex with the drug candidate alpibectir | | Authors: | Edoo, Z., Frita, R., Grosse, C., Bourotte, M., Moune, M., Antoine, R., Trebosc, V., Schellhorn, B., Dreneau, A., Hofmann, L., Kemmer, C., Lociuro, S., Dale, G.E., Jung, F., Perez-Herran, E., Mendoza, A., Rebollo Lopez, M.J., Ghidelli-Disse, S., Drewes, G., Mathys, V., Soetaert, K., Megalizzi, V., Wintjens, R., Barros Aguirre, D., Remuinan, M.D., Gitzinger, M., Deprez, B., Willand, N., Pieren, M., Baulard, A.R. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rcy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rcz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the enoyl-ACP reductase FabV from Pseudomonas aeruginosa with NADH cofactor | | Authors: | Vandebroek, L., Van Olmen, F., Voet, A.R.D., Verwilst, P. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rd4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rd9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rdb | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase N252E variant in complex with Fe and ACV under anaerobic conditions | | Authors: | Stead, A., Rabe, P., Schofield, C.J. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rdc | | Status: | HPUB -- hold until publication | | Title: | Galectin-1 in complex with thiogalactoside derivative | | Authors: | Hakansson, M., Diehl, C., Peterson, K., Zetterberg, F., Nilsson, U. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rde | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-08 | | Release date: | 2024-12-08 |
|
| PDBID: | 8rdg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-08 |
|
