| PDBID: | 8vwt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8vwu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8vwv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8vww | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8vwx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8vwy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8vwz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8vx1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8vx2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8vx3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a (p)ppApp synthetase from Streptomyces albidoflavus | | Authors: | Ahmad, S., Tsang, K.K., Schiefer, V., Kim, Y., Whitney, J.C. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8vx4 | | Status: | HPUB -- hold until publication | | Title: | Human OGG1 bound to a 35-bp DNA with an 8-oxoG in the middle | | Authors: | You, Q., Li, H. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8vx5 | | Status: | HPUB -- hold until publication | | Title: | Nucleosome core particle containing an 8-oxoG damage site | | Authors: | You, Q., Li, H. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8vx6 | | Status: | HPUB -- hold until publication | | Title: | Human OGG1 bound at the nucleosomal DNA entry site | | Authors: | You, Q., Li, H. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8vx7 | | Status: | HPUB -- hold until publication | | Title: | Computationally designed tunable C2 symmetric tandem repeat homodimer, bound to cyclic peptide | | Authors: | Kennedy, M.A., Stoddard, B.L., Said, M. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8vx8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8vxb | | Status: | HOLD -- hold until a certain date | | Title: | Structure of ANT(6)-Ib from Campylobacter fetus subsp fetus complexed with hydrated streptomycin | | Authors: | Nalam, P., Cook, P., Smith, B. | | Deposition date: | 2024-02-04 | | Release date: | 2025-02-04 | | Sequence: | >Entity 1
MKMRTEKQIYDTILNFAKADDRIRVVTLEGSRTNINIIPDDFQDYDITFFVTDMQSFINSDEWLNVFGERLIMQKPEDMELFPKEEKGYSYLMLFWDGVKIDLTLLPLEVLDEYFTWDKLVKLLLDKDNRVTNIPVPTDEDYYIEHPTARSFDDCCNEFWNTVTYVVKGLCRKEILFAIDHLNNIVRMELLRMISWKVGIEQGYSFSLGKNYKFLERYISPELWKKILATYNMGSYTEMWKSLELCMGIFRMVSKEVAQCLNYLYPDYDKNISNYVIRQKEKYQRDPNSSSVDKLAAALEHHHHHH
|
|
| PDBID: | 8vxg | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | The crystal structure of CYP125MRCA, an ancestrally reconstructed CYP125 enzyme | | Authors: | Doherty, D.Z., Bruning, J.B., Bell, S.G. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxi | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | The crystal structure of sitosterol-bound CYP125MRCA | | Authors: | Doherty, D.Z., Bell, S.G. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of the Apo Bacillus subtilis GabR C-terminal Effector-binding and Oligomerization Domain | | Authors: | Kaley, N.E., Liu, D. | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8vxl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of the External Aldimine Complex of Pyridoxal-5''-Tetrazole and (S)-4-amino-5-phenoxypentanoate with the Bacillus subtilis GabR C-terminal Effector-binding and Oligomerization Domain | | Authors: | Kaley, N.E., Liveris, Z.J., Becker, D.P., Liu, D. | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8vxm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8vxn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8vxo | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of modified JEV virus E protein dimer | | Authors: | Galkin, A., Pozharski, E., Li, Y. | | Deposition date: | 2024-02-05 | | Release date: | 2025-02-05 |
|
