PDBID: | 8w82 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 |
|
PDBID: | 8w8g | Status: | HPUB -- hold until publication | Title: | Crystal structure of human TRF1 with PinX1 | Authors: | Lei, M., Wu, J. | Deposition date: | 2023-09-02 |
|
PDBID: | 8w8h | Status: | HPUB -- hold until publication | Title: | 2-Ketoglutarate-Dependent Dioxygenase | Authors: | Zheng, C.N., Wei, W.Q. | Deposition date: | 2023-09-02 |
|
PDBID: | 8w8i | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-02 | Sequence: | >Entity 1 MKKLLIAAGSVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIALHHHHHH
>Entity 2 MKKLLIAAGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMYWVRQAPGKGLEWVSKINTNGLITKYPDSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCARSPSGFNRGQGTLVTVSSHHHHHH
|
|
PDBID: | 8w8j | Status: | HPUB -- hold until publication | Title: | Crystal structure of bacterial prolyl-tRNA synthetase in complex with inhibitor PAA-19 | Authors: | Luo, Z., Zhou, H. | Deposition date: | 2023-09-03 |
|
PDBID: | 8w8l | Status: | HPUB -- hold until publication | Title: | Crystal structure of bacterial prolyl-tRNA synthetase in complex with inhibitor PAA-38 | Authors: | Luo, Z., Zhou, H. | Deposition date: | 2023-09-03 |
|
PDBID: | 8w8m | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8u | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8v | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8w | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of alpha-MSH-MC3R-Gs_Nb35 complex | Authors: | Chen, Q., Fu, J. | Deposition date: | 2023-09-04 | Release date: | 2025-03-04 |
|
PDBID: | 8w8x | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of beta-MSH-MC3R-Gs_Nb35 complex | Authors: | Chen, Q., Fu, J. | Deposition date: | 2023-09-04 | Release date: | 2025-03-04 |
|
PDBID: | 8w8y | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of gamma-MSH-MC3R-Gs_Nb35 complex | Authors: | Chen, Q., Fu, J. | Deposition date: | 2023-09-04 | Release date: | 2025-03-04 |
|
PDBID: | 8w8z | Status: | HPUB -- hold until publication | Title: | Escherichia coli ferritin mutant-M52H | Authors: | Zhao, G., Zeng, R. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w90 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-04 | Release date: | 2024-09-04 |
|
PDBID: | 8w91 | Status: | HPUB -- hold until publication | Title: | Azumapecten Farreri homopolymeric ferritin mutant - H2KE exposed to H2O2 for 3 min | Authors: | Zhang, T., Jiao, R. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w92 | Status: | HPUB -- hold until publication | Title: | human H ferritin with 2 Fe(II)/subunit loading | Authors: | Zhang, T., Jiao, R. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w93 | Status: | HPUB -- hold until publication | Title: | Azumapecten Farreri homopolymeric ferritin (ApF) mutant-H2KE | Authors: | Zhang, T., Jiao, R. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w94 | Status: | HPUB -- hold until publication | Title: | Azumapecten Farreri homopolymeric ferritin (ApF) mutant-H2KE exposed to H2O2 for 2 s | Authors: | Zhang, T., Jiao, R. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w95 | Status: | HPUB -- hold until publication | Title: | Azumapecten Farreri homopolymeric ferritin (ApF) mutant-H2KE exposed to H2O2 for 20 s | Authors: | Zhang, T., Jiao, R. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w96 | Status: | HPUB -- hold until publication | Title: | SmChiA with diacetyl chitobiose | Authors: | Yoshiko, T., Akihiko, N. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w97 | Status: | HPUB -- hold until publication | Title: | De novo design protein -PK16 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w98 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 |
|
PDBID: | 8w99 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8w9g | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 |
|
PDBID: | 8w9i | Status: | HPUB -- hold until publication | Title: | Crystal structure of bacterial prolyl-tRNA synthetase in complex with inhibitor PAA-5 | Authors: | Luo, Z., Zhou, H. | Deposition date: | 2023-09-05 |
|