PDBID: | 8tqt | Status: | HPUB -- hold until publication | Title: | MPI52 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-08 |
|
PDBID: | 8tqu | Status: | HPUB -- hold until publication | Title: | MPI51 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-08 |
|
PDBID: | 8tqw | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-08 |
|
PDBID: | 8tqy | Status: | HPUB -- hold until publication | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | Deposition date: | 2023-08-08 | Release date: | 2025-01-08 | Sequence: | >Entity 1 MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
PDBID: | 8tr0 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-09 |
|
PDBID: | 8tr2 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-09 |
|
PDBID: | 8tr5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8tr6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8tr7 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-09 |
|
PDBID: | 8tr8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8tr9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8tra | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8trb | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-09 |
|
PDBID: | 8trc | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2024-11-30 |
|
PDBID: | 8trd | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8trf | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2025-02-09 |
|
PDBID: | 8trh | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-09 |
|
PDBID: | 8tri | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8trj | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8trk | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8trl | Status: | HPUB -- hold until publication | Title: | T cell recognition of citrullinated alpha-enolase peptide presented by HLA-DR4 | Authors: | Lim, J.J., Loh, T.J., Reid, H.H., Rossjohn, J. | Deposition date: | 2023-08-09 |
|
PDBID: | 8trp | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-10 | Release date: | 2024-08-10 |
|
PDBID: | 8trq | Status: | HPUB -- hold until publication | Title: | T cell recognition of citrullinated vimentin peptide presented by HLA-DR4 | Authors: | Loh, T.J., Lim, J.J., Reid, H.H., Rossjohn, J. | Deposition date: | 2023-08-10 |
|
PDBID: | 8trr | Status: | HPUB -- hold until publication | Title: | T cell recognition of citrullinated vimentin peptide presented by HLA-DR4 | Authors: | Loh, T.J., Lim, J.J., Reid, H.H., Rossjohn, J. | Deposition date: | 2023-08-10 |
|
PDBID: | 8tru | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|