PDBID: | 8u3o | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 Main Protease A173V in complex with CDD-1819 | Authors: | Nnabuife, C., Palzkill, T. | Deposition date: | 2023-09-08 |
|
PDBID: | 8u3p | Status: | HPUB -- hold until publication | Title: | 1.79 Angstrom resolution crystal structure of KatG from Mycobacterium tuberculosis with an MYW cofactor after heat incubation for 60 minutes | Authors: | Liu, A., Li, J., Ran, D. | Deposition date: | 2023-09-08 |
|
PDBID: | 8u3s | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-08 |
|
PDBID: | 8u3u | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the SARS-CoV-2 Omicron nsp5 main protease (Mpro) E166V mutant in complex with inhibitor Nirmatrelvir (PF-07321332) | Authors: | Neilsen, G., Kirby, K.A., Sarafianos, S.G. | Deposition date: | 2023-09-08 |
|
PDBID: | 8u40 | Status: | HPUB -- hold until publication | Title: | Crystal structure of main protease of SARS-CoV-2 complexed with inhibitor | Authors: | Chen, P., Arutyunova, E., Lu, J., Young, H.S., Lemieux, M.J. | Deposition date: | 2023-09-08 | Release date: | 2025-03-05 |
|
PDBID: | 8u4g | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-10 |
|
PDBID: | 8u4m | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-10 |
|
PDBID: | 8u4x | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of PsBphP in Pr state | Authors: | Basore, K., Burgie, E.S., Vierstra, D. | Deposition date: | 2023-09-11 |
|
PDBID: | 8u4y | Status: | HPUB -- hold until publication | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) L50F Mutant | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | Deposition date: | 2023-09-11 |
|
PDBID: | 8u52 | Status: | HPUB -- hold until publication | Title: | Co-crystal structure of human transthyretin conjugated to the stilbene substructure derived from reaction with the fluorogenic covalent kinetic stabilizer A2 | Authors: | Yan, N.L., Nugroho, K., Kline, G.M., Basanta, B., Lander, G.C., Wilson, I.A., Kelly, J.W. | Deposition date: | 2023-09-11 |
|
PDBID: | 8u54 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u56 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-12 |
|
PDBID: | 8u58 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u59 | Status: | HPUB -- hold until publication | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | Authors: | Wang, G., Heras, B. | Deposition date: | 2023-09-12 | Sequence: | >Entity 1 AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
PDBID: | 8u5c | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5i | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of human IDO1 bound to Compound 23 | Authors: | Steinbacher, S., Lammens, A., Harris, S.F. | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5l | Status: | HPUB -- hold until publication | Title: | MAU868, a novel human-derived monoclonal neutralizing antibody targeting BK virus VP1 | Authors: | Knapp, M.S., Ornelas, E. | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5n | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5o | Status: | HPUB -- hold until publication | Title: | The structure of the catalytic domain of NanI sialdase in complex with Neu5Gc | Authors: | Medley, B.J., Low, K.E., Garber, J.M., Gray, T.E., Liu, L., Klassen, L., Fordwour, O.B., Inglis, G.D., Boons, G.J., Zandberg, W.F., Abbott, W.D., Boraston, A.B. | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5q | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5s | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5v | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-13 |
|
PDBID: | 8u5w | Status: | HPUB -- hold until publication | Title: | De novo designed pentameric helical bundle protein | Authors: | Bick, M.J., Xu, C., Sankaran, B., Baker, D. | Deposition date: | 2023-09-13 |
|
PDBID: | 8u5x | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-13 |
|
PDBID: | 8u62 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of PsBphP in Pfr state, Dimer of Dimers FL | Authors: | Basore, K., Burgie, E.S., Vierstra, D. | Deposition date: | 2023-09-13 |
|