| PDBID: | 8y7d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a cell adhesion molecule | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a synaptic adhesion receptor | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7b | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a synaptic adhesion protein | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y79 | | Status: | HPUB -- hold until publication | | Title: | extracellular domain of a synaptic adhesion receptor in complex with a long peptide | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y76 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y77 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7n | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Nur77 LBD in complex with N-(2''-(methyl(pentyl)amino)-[4,4''-bipyridin]-2-yl)cinnamamide | | Authors: | Hong, W.B., Lin, T.W. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7a | | Status: | HPUB -- hold until publication | | Title: | extracellular domains of a synaptic adhesion receptor in complex with a cell adhesion molecule | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7h | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7k | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y78 | | Status: | HPUB -- hold until publication | | Title: | Extracellular domain of a synaptic adhesion molecule in complex with a short peptide | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7q | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8rwf | | Status: | HPUB -- hold until publication | | Title: | Domains 1 and 2 of Bacillus anthracis Sap S-layer in complex with Nb692 | | Authors: | Sogues, A., Remaut, H. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8rwg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8rwh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxb | | Status: | HOLD -- hold until a certain date | | Title: | Structure of ANT(6)-Ib from Campylobacter fetus subsp fetus complexed with hydrated streptomycin | | Authors: | Nalam, P., Cook, P., Smith, B. | | Deposition date: | 2024-02-04 | | Release date: | 2025-02-04 | | Sequence: | >Entity 1
MKMRTEKQIYDTILNFAKADDRIRVVTLEGSRTNINIIPDDFQDYDITFFVTDMQSFINSDEWLNVFGERLIMQKPEDMELFPKEEKGYSYLMLFWDGVKIDLTLLPLEVLDEYFTWDKLVKLLLDKDNRVTNIPVPTDEDYYIEHPTARSFDDCCNEFWNTVTYVVKGLCRKEILFAIDHLNNIVRMELLRMISWKVGIEQGYSFSLGKNYKFLERYISPELWKKILATYNMGSYTEMWKSLELCMGIFRMVSKEVAQCLNYLYPDYDKNISNYVIRQKEKYQRDPNSSSVDKLAAALEHHHHHH
|
|
| PDBID: | 8vxg | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | The crystal structure of CYP125MRCA, an ancestrally reconstructed CYP125 enzyme | | Authors: | Doherty, D.Z., Bruning, J.B., Bell, S.G. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxi | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | The crystal structure of sitosterol-bound CYP125MRCA | | Authors: | Doherty, D.Z., Bell, S.G. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y6t | | Status: | HPUB -- hold until publication | | Title: | Chitinase TfeC from Yersinia pseudotuberculosis | | Authors: | Cui, R., Li, D.F. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y6x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
