| PDBID: | 8s0r | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-14 | | Release date: | 2025-02-14 |
|
| PDBID: | 8s0v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Cryptosporidium parvum - Trypanosoma cruzi mutant lysyl tRNA synthetase in complex with inhibitor | | Authors: | Dawson, A., Wyllie, S. | | Deposition date: | 2024-02-14 |
|
| PDBID: | 8w10 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Plasmodium vivax PMX-MK7602 inhibitor complex | | Authors: | Hodder, A.N., Scally, S.W., Cowman, A.F. | | Deposition date: | 2024-02-14 |
|
| PDBID: | 8w11 | | Status: | HPUB -- hold until publication | | Title: | Structure of human PIN1 covalently derivatized with SuFEx compound | | Authors: | Louie, G.V., Noel, J.P., Wang, W.-M., Kelly, J.W. | | Deposition date: | 2024-02-14 |
|
| PDBID: | 8ybi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-14 |
|
| PDBID: | 8rzs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8rzt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8s08 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8s02 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8s05 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | ArnAB complex an archaeal ortholog of the Sec23/24 core motif | | Authors: | Korf, L., Steinchen, W., Watad, M., Bezold, F., Vogt, M.S., Selbach, L., Penner, A., Tourte, M., Hepp, S., Albers, S.V., Essen, L.-O. | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8rzz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 | | Sequence: | >Entity 1
MDLAKLGLKEVMPTKINLEGLVGDHAFSMEGVGEGNILEGTQEVKISVTKGAPLPFAFDIVSVAF(CRO)NRAYTGYPEEISDYFLQSFPEGFTYERNIRYQDGGTAIVKSDISLEDGKFIVNVDFKAKDLRRMGPVMQQDIVGMQPSYESMYTNVTSVIGECIIAFKLQTGKHFTYHMRTVYKSKKPVETMPLYHFIQHRLVKTNVDTASGYVVQHETAIAAHSTIKKIEGSLP
>Entity 2
MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAKKFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQSGLEVLFQ
|
|
| PDBID: | 8rzu | | Status: | HPUB -- hold until publication | | Title: | Structure of human SETD2 L1609P mutant in complex with SAM and H3K36M peptide | | Authors: | Mechaly, A.E., Michail, C., Haouz, A., Rodrigues-Lima, F. | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8s00 | | Status: | HPUB -- hold until publication | | Title: | CpKRS complexed with lysine and an inhibitor | | Authors: | Dawson, A., Baragana, B., Caldwell, N. | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8ybd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8rza | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-12 |
|
| PDBID: | 8rzm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-12 |
|
| PDBID: | 8rzn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-12 |
|
| PDBID: | 8rzr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-12 |
|
| PDBID: | 8rzq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-12 |
|
| PDBID: | 8rzo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-12 |
|
| PDBID: | 8rz4 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of D-amino acid transaminase from Haliscomenobacter hydrossis (holo form) after 5 sec of soaking with phenilhydrazine | | Authors: | Matyuta, I.O., Bakunova, A.K., Bezsudnova, E.Y., Popov, V.O., Boyko, K.M. | | Deposition date: | 2024-02-12 |
|
| PDBID: | 8rz5 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of D-amino acid transaminase from Haliscomenobacter hydrossis (apo form) after 30 sec of soaking with phenilhydrazine | | Authors: | Matyuta, I.O., Bakunova, A.K., Bezsudnova, E.Y., Popov, V.O., Boyko, K.M. | | Deposition date: | 2024-02-12 |
|
| PDBID: | 8rz7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-12 |
|
| PDBID: | 8rzf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-12 |
|
| PDBID: | 8rz8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-12 |
|
