| PDBID: | 9fqb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fq1 | | Status: | HPUB -- hold until publication | | Title: | Structure of the disease-causing mutant P20S of human KCTD1 | | Authors: | Balasco, N., Ruggiero, A., Smaldone, G., Esposito, L., Berisio, R., Vitagliano, L. | | Deposition date: | 2024-06-14 | | Sequence: | >Entity 1
MSRPLITRSPASPLNNQGISTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD
|
|
| PDBID: | 9fq4 | | Status: | HPUB -- hold until publication | | Title: | Glyceraldehyde 3-phosphate dehydrogenase A (GAPDHA) NADP holoenzyme, from Helicobacter pylori, with active site cysteine oxidised to sulfenic acid | | Authors: | Foster, S.P., Moody, P.C.E. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fpy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fq6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fq5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phosphoserine phosphatase (SerB) from Brucella melitensis | | Authors: | Scaillet, T., Wouters, J. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fq7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Perkinsus marinus Respiratory supercomplex CII2CIII2CIV2 in c1 sate | | Authors: | Wu, F., Amunts, A. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fq8 | | Status: | HPUB -- hold until publication | | Title: | Perkinsus marinus Respiratory complex CIV | | Authors: | Wu, F., Amunts, A. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zxi | | Status: | HOLD -- hold until a certain date | | Title: | Peptide channel interactions in the truncated VhChiP nanopore | | Authors: | Sanram, S., Suginta, W., Robinson, R.C. | | Deposition date: | 2024-06-14 | | Release date: | 2025-06-14 |
|
| PDBID: | 8zxb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zxd | | Status: | HPUB -- hold until publication | | Title: | the Planar Cell Polarity Core Protein Vangl1 | | Authors: | Zhang, F., Chen, S. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zxn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zxh | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the red fluorescent protein mYongHong at pH 4.5 | | Authors: | Li, Y., Zheng, Q., Li, S., Fu, Z. | | Deposition date: | 2024-06-14 | | Release date: | 2025-06-14 |
|
| PDBID: | 8zxo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the red fluorescent protein mScarletH at pH8.5 | | Authors: | Li, Y., Li, M., Fan, S., Zheng, Q., Li, S., Fu, Z. | | Deposition date: | 2024-06-14 | | Release date: | 2025-06-14 |
|
| PDBID: | 8zxk | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of trimethylamine transporter TmaT binding with TMA | | Authors: | Chao, G. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zxp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zxg | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-14 | | Release date: | 2025-06-14 |
|
| PDBID: | 8zxa | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase from Aspergillus oryzae | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zxc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR solution structures of ASH1L BRD-PHD domain in complex with H3K4me2 peptide | | Authors: | Zeng, L., Zhou, M.-M. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zx8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zx9 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zxq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zxr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zxj | | Status: | HPUB -- hold until publication | | Title: | Sweet protein MNEI-Mut 6-1 | | Authors: | You, T.J., Liu, S. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zxl | | Status: | HOLD -- hold until a certain date | | Title: | Structure of a hierarchical intermediate region (spindlefirbil) of human collagen type | | Authors: | Fang, B.H., Zhang, L.J. | | Deposition date: | 2024-06-14 | | Release date: | 2025-06-14 | | Sequence: | >Entity 1
GAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQ
|
|
