| PDBID: | 9g1q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 | | Sequence: | >Entity 1
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
| PDBID: | 9g1r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 | | Sequence: | >Entity 1
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
| PDBID: | 9g1s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 | | Sequence: | >Entity 1
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
| PDBID: | 9g25 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g28 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g2d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g2e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ipc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ipd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ipe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ip8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ip9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ipa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ipb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ip7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ip6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ip0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ioy | | Status: | HPUB -- hold until publication | | Title: | Isophthalate dioxygenase in complex with isophthalate | | Authors: | Jangid, K., Mahto, J.K., Kumar, P. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ip2 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Cryo-EM structure of the RNA-dependent RNA polymerase complex from Marburg virus | | Authors: | Li, G., Du, T., Ru, H. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ip4 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Cryo-EM structure of the RNA-dependent RNA polymerase complex from Marburg virus | | Authors: | Li, G., Du, T., Ru, H. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ipk | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-07-10 | | Release date: | 2025-07-10 |
|
| PDBID: | 9ipl | | Status: | HPUB -- hold until publication | | Title: | A tetrapyrrole binding domain variant of CoaR in closed conformation at 2.28 angstrom resolution | | Authors: | Liu, X.C. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ipi | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-07-10 | | Release date: | 2025-07-10 |
|
| PDBID: | 9ipj | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-07-10 | | Release date: | 2025-07-10 |
|
