| PDBID: | 9ixv | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of MERS-CoV S1-NTD bound with KNIH-88 Fab | | Authors: | Jeon, H., Yoo, Y., Park, K., Choi, K. | | Deposition date: | 2024-07-29 | | Release date: | 2025-07-29 |
|
| PDBID: | 9ixu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-29 |
|
| PDBID: | 9ixt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TEAD3 YAP binding domain with compound 2 | | Authors: | Yoo, Y. | | Deposition date: | 2024-07-29 |
|
| PDBID: | 9ixs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TEAD3 YAP binding domain with compound 1 | | Authors: | Yoo, Y. | | Deposition date: | 2024-07-29 |
|
| PDBID: | 9ixm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-29 |
|
| PDBID: | 9ixl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the CYP153A double mutant L354T/V456G from Marinobacter aquaeolei | | Authors: | Qin, M.M., Jiang, Y.P., Cong, Z.Q., Zhao, P.X. | | Deposition date: | 2024-07-29 |
|
| PDBID: | 9ixk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | human serum albumin-palladium(II) agent complex | | Authors: | Zhang, Z.L., Zhang, Z.L. | | Deposition date: | 2024-07-28 | | Release date: | 2025-07-28 |
|
| PDBID: | 9ixj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-28 |
|
| PDBID: | 9ixi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | VLP structure of Chikungunya virus, 2f block. | | Authors: | Han, X., Ji, C., Wang, F., Tian, S., Gao, F.G., Yan, J. | | Deposition date: | 2024-07-28 |
|
| PDBID: | 9ixh | | Status: | HPUB -- hold until publication | | Title: | Apg mutant enzyme D448A of the human gut flora K. grimontii TD1 acarbose hydrolase | | Authors: | Zhou, J.H., Huang, J.Y. | | Deposition date: | 2024-07-27 |
|
| PDBID: | 9ixg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Manganese-free N(omega)-hydroxy-L-arginine hydrolase without oxidized Cys86 | | Authors: | Oda, K., Matoba, Y. | | Deposition date: | 2024-07-27 |
|
| PDBID: | 9ixf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Manganese-free N(omega)-hydroxy-L-arginine hydrolase with oxidized Cys86. | | Authors: | Oda, K., Matoba, Y. | | Deposition date: | 2024-07-27 |
|
| PDBID: | 9ixe | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Copper-bound N(omega)-hydroxy-L-arginine hydrolase without oxidized Cys86 | | Authors: | Oda, K., Matoba, Y. | | Deposition date: | 2024-07-27 |
|
| PDBID: | 9ixd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Copper-bound N(omega)-hydroxy-L-arginine hydrolase with oxidized Cys86 | | Authors: | Oda, K., Matoba, Y. | | Deposition date: | 2024-07-27 |
|
| PDBID: | 9ixc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Manganese-rebound N(omega)-hydroxy-L-arginine hydrolase with oxidized Cys86 | | Authors: | Oda, K., Matoba, Y. | | Deposition date: | 2024-07-27 |
|
| PDBID: | 9ixb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of tubulin and nitrogen-containing heterocyclic substituted podophyllotoxin derivatives complex | | Authors: | Bi, J., Zhao, W. | | Deposition date: | 2024-07-27 |
|
| PDBID: | 9ixa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of chikungunya virus glycoprotein E1-E2 with C34 Fab. | | Authors: | Han, X., Ji, C., Wang, F., Tian, S., Gao, F.G., Yan, J. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix9 | | Status: | HPUB -- hold until publication | | Title: | Mutant H286T Crystal Structure of Two-domain bacterial laccase from the actinobacterium Streptomyces carpinensis VKM Ac-1300 | | Authors: | Gabdulkhakov, A.G., Tishchenko, T.V., Trubitsina, L., Trubitsin, I., Leontievsky, A., Lisov, A. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix8 | | Status: | HPUB -- hold until publication | | Title: | Crystallization and structural characterization of phosphopentomutase from the hyperthermophilic archaeon Thermococcus kodakarensis | | Authors: | Naz, Z., Lubkowski, T.J., Saleem, M., Rahman, M., Wlodawer, A., Rashid, N. | | Deposition date: | 2024-07-26 | | Sequence: | >Entity 1
RLFGTAGIRGTLWEKVTPELAMKVGMAVGTYKSGKALVGRDGRTSSVMLKNAMISGLLSTGMEVLDADLIPTPALAWGTRKLADAGVMITASHNPPTDNGVKVFNGDGTEFYVEQERGLEEIIFSGNFRKARWDEIKPVRNVEVIPDYINAVLDFVGHETNLKVLYDGANGAGSLVAPYLLREMGAKVLSVNAHVDGHFPGRKPEPRYENIAYLGKLVRELGVDLAIAQDGDADRIAVFDEKGNYVDEDTVIALFAKLYVEEHGGGTVVVSIDTGSRIDAVVERAGGRVVRIPLGQPHDGIKRYKAIFAAEPWKLVHPKFGPWIDPFVTMGLLIKLIDENGPLSELVKEIPTYYLKKANVLCPDEYKAEVVRRAAEEVERKLSSEIKEVLTISGFRIALNDGSWILIRPSGTEPKIRVVAEAPTEKRRDELFEMAYSTVSRIVKEAEKK
|
|
| PDBID: | 9ix7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of homolog of dihydroxyacid dehydratase(AstD) from Aspergillus terreus | | Authors: | Huang, W.X., Zhang, P.X., Zhou, J.H. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Cas12X2 with crRNA | | Authors: | Xi, Z. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix5 | | Status: | HPUB -- hold until publication | | Title: | An agonist(compound 15n) of Thyroid Hormone Receptor B | | Authors: | Yao, B., Li, Y. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with compound 18 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with TAK-632 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
