PDBID: | 8r0d | Status: | HPUB -- hold until publication | Title: | Crystal structure of Borneoldehydrogenase ancestor N39 | Authors: | Helmer, C.P.O., Dimos, N., Loll, B. | Deposition date: | 2023-10-31 |
|
PDBID: | 8r0c | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-31 |
|
PDBID: | 8r01 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-10-30 | Release date: | 2024-10-30 |
|
PDBID: | 8r00 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the human PXR ligand-binding domain in complex with furanodienone | Authors: | Bourguet, W., Carivenc, C., Sirounian, S. | Deposition date: | 2023-10-30 |
|
PDBID: | 8qzy | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-30 |
|
PDBID: | 8qzu | Status: | HPUB -- hold until publication | Title: | XhpG hydrolase mutant S98A of Xenorhabdus hominickii | Authors: | Calderari, A., Gruez, A., Weissman, K.J. | Deposition date: | 2023-10-30 |
|
PDBID: | 8qzt | Status: | HPUB -- hold until publication | Title: | Single particle cryo-EM co-structure of E. coli AcrB with bound BDM91531 inhibitor at 3.52 A resolution | Authors: | Boernsen, C., Mueller, R.T., Pos, K.M., Frangakis, A.S. | Deposition date: | 2023-10-29 |
|
PDBID: | 8qzq | Status: | HPUB -- hold until publication | Title: | Single particle cryo-EM co-structure of E. coli AcrB with bound BDM91531 inhibitor | Authors: | Boernsen, C., Mueller, R.T., Pos, K.M., Frangakis, A.S. | Deposition date: | 2023-10-29 |
|
PDBID: | 8qzp | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-10-28 |
|
PDBID: | 8qzm | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-27 |
|
PDBID: | 8qzl | Status: | HPUB -- hold until publication | Title: | Single particle cryo-EM co-structure of Klebsiella pneumoniae AcrB with the BDM91288 efflux pump inhibitor at 3.42 Angstrom resolution | Authors: | Boernsen, C., Mueller, R.T., Pos, K.M., Frangakis, A.S. | Deposition date: | 2023-10-27 |
|
PDBID: | 8qzb | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-26 |
|
PDBID: | 8qza | Status: | HPUB -- hold until publication | Title: | D-2-hydroxyacid dehydrogenase (D2-HDH) from Haloferax mediterranei apo-enzyme (2.25 A resolution) | Authors: | Baker, P.J., Barrett, J.R., Dakhil, A.A.A.B., Domenech, J., Bisson, C., Pramanpol, N., Sedelnikova, S.E., Ferrer, J., Rice, D.W. | Deposition date: | 2023-10-26 |
|
PDBID: | 8qz7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-26 |
|
PDBID: | 8qz6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-26 |
|
PDBID: | 8qz5 | Status: | HPUB -- hold until publication | Title: | Alpha-1-antitrypsin (Tyr244Phe) in the native conformation | Authors: | Aldobiyan, I., Lomas, D.A., Irving, J.A. | Deposition date: | 2023-10-26 | Sequence: | >Entity 1 MRGSHHHHHHTDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQH(OCS)KKLSSWVLLMKFLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
|
|
PDBID: | 8qz0 | Status: | HOLD -- hold until a certain date | Title: | SWR1-hexasome-dimer complex | Authors: | Jalal, A.S.B., Wigley, D.B. | Deposition date: | 2023-10-26 | Release date: | 2024-10-26 |
|
PDBID: | 8qyz | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-10-26 | Release date: | 2024-10-26 |
|
PDBID: | 8qyy | Status: | HPUB -- hold until publication | Title: | Zorya anti-bacteriophage defense system ZorAB, ZorA delta_435-729, ZorA tail tip deletion. | Authors: | Hu, H., Taylor, N.M.I. | Deposition date: | 2023-10-26 |
|
PDBID: | 8qyx | Status: | HPUB -- hold until publication | Title: | Human 60S ribosomal subunit | Authors: | Wiechert, F., Schacherl, M., Sprink, T. | Deposition date: | 2023-10-26 |
|
PDBID: | 8qyv | Status: | HOLD -- hold until a certain date | Title: | SWR1-hexasome complex | Authors: | Jalal, A.S.B., Wigley, D.B. | Deposition date: | 2023-10-26 | Release date: | 2024-10-26 |
|
PDBID: | 8qyk | Status: | HPUB -- hold until publication | Title: | Zorya anti-bacteriophage defense system ZorAB, ZorA delta_359-592, ZorA tail middle deletion. | Authors: | Hu, H., Taylor, N.M.I. | Deposition date: | 2023-10-26 |
|
PDBID: | 8qyh | Status: | HPUB -- hold until publication | Title: | Zorya anti-bacteriophage defense system ZorAB ZorA E86A_E89A, Calcium binding site mutation | Authors: | Hu, H., Taylor, N.M.I. | Deposition date: | 2023-10-26 |
|
PDBID: | 8qyd | Status: | HPUB -- hold until publication | Title: | Zorya anti-bacteriophage defense system ZorAB | Authors: | Hu, H., Taylor, N.M.I. | Deposition date: | 2023-10-25 |
|
PDBID: | 8qyc | Status: | HPUB -- hold until publication | Title: | Zorya anti-bacteriophage defense system ZorD in complex with ATP-gamma-S | Authors: | Hu, H., Taylor, N.M.I. | Deposition date: | 2023-10-25 |
|