Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
Status search: 12798 results
PDBID:8tik
Status:HPUB -- hold until publication
Title:Human ACKR3 phosphorylated by GRK2 in complex with Arrestin2 reconstructed without receptor/micelle
Authors:Chen, Q., Tesmer, J.J.G.
Deposition date:2023-07-19
Release date:2025-01-22
PDBID:8tij
Status:HPUB -- hold until publication
Title:Human ACKR3 phosphorylated by GRK5 in complex with Arrestin2 reconstructed without receptor/micelle
Authors:Chen, Q., Tesmer, J.J.G.
Deposition date:2023-07-19
Release date:2025-01-22
PDBID:8tii
Status:HPUB -- hold until publication
Title:Human ACKR3 phosphorylated by GRK2 in complex with Arrestin2 in nanodisc
Authors:Chen, Q., Tesmer, J.J.G.
Deposition date:2023-07-19
Release date:2025-01-22
PDBID:8tih
Status:HPUB -- hold until publication
Title:Human ACKR3 phosphorylated by GRK2 in complex with Arrestin2
Authors:Chen, Q., Tesmer, J.J.G.
Deposition date:2023-07-19
Release date:2025-01-22
PDBID:8thw
Status:HPUB -- hold until publication
Deposition date:2023-07-18
Release date:2024-11-17
PDBID:8thq
Status:HPUB -- hold until publication
Title:Nonamer RNA bound to hAgo2-PAZ
Authors:Pallan, P.S., Harp, J.M., Egli, M.
Deposition date:2023-07-17
PDBID:8tgx
Status:REPL -- author sent new coordinates, entry to be reprocessed
Deposition date:2023-07-13
PDBID:8tgw
Status:HPUB -- hold until publication
Title:Cryo-EM structure of 1059 SOSIP trimer purified via Galanthus nivalis lectin chromatography
Authors:Pothula, K., Parsons, R.J., Acharya, P.
Deposition date:2023-07-13
PDBID:8tgu
Status:HPUB -- hold until publication
Title:Cryo-EM structure of BG505 SOSIP trimer purified via Galanthus nivalis lectin chromatography
Authors:Parsons, R.J., Pothula, K., Acharya, P.
Deposition date:2023-07-13
PDBID:8tgs
Status:AUTH -- processed, waiting for author review and approval
Title:The crystal structure of the post-reactive state of UDP-sugar pyrophosphorylase from Leishmania major in complex with product UDP-Glucose and by-product analog VO4 (orthovanadate)
Authors:Prakash, O., Fuehring, J.I., Baruch, P., Routier, F.H., Fedorov, R.
Deposition date:2023-07-13
Release date:2025-01-13
PDBID:8tg2
Status:AUTH -- processed, waiting for author review and approval
Title:The crystal structure of the post-reactive state of UDP-sugar pyrophosphorylase from Leishmania major in complex with products UDP-Glucose and PPi
Authors:Prakash, O., Fuehring, J.I., Baruch, P., Routier, F.H., Fedorov, R.
Deposition date:2023-07-12
Release date:2025-01-25
PDBID:8tg0
Status:HPUB -- hold until publication
Title:Solution NMR structure of the cold shock domain of the Arabidopsis thaliana glycine-rich protein AtGRP2
Authors:Pougy, K.C., Almeida, F.C.L., Pinheiro, A.S.
Deposition date:2023-07-12
Release date:2025-01-12
PDBID:8tft
Status:HPUB -- hold until publication
Title:Fab of O13-1 human IgG1 antibody bound to IgV domain of human TIM-3
Authors:Oganesyan, V.Y., van Dyk, N., Mazor, Y., Yang, C.
Deposition date:2023-07-11
PDBID:8tfd
Status:HPUB -- hold until publication
Deposition date:2023-07-10
Release date:2025-01-08
PDBID:8tf6
Status:HPUB -- hold until publication
Title:X-ray Crystal Structure Determination of Dihydromethanopterin Reductase A (DmrA) from Methylobacterium extorquens AM1 by Se-SAD Phasing in a F222 Crystal form at 2.70 Angstroms Resolution
Authors:Axelrod, H.L., Rasche, M., Cascio, D., Arbing, M., Collazo, M.J., Potla, P.S., ?
Deposition date:2023-07-07
Release date:2025-01-08
Sequence:

>Entity 1


(MSE)IDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALT(MSE)GHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
PDBID:8tf5
Status:HPUB -- hold until publication
Deposition date:2023-07-07
Release date:2025-01-07
PDBID:8tf1
Status:HPUB -- hold until publication
Title:Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH and Pyridoxal
Authors:Donkor, A.K., Safo, M.K., Musayev, F.N.
Deposition date:2023-07-07
Release date:2024-08-01
PDBID:8tf0
Status:HPUB -- hold until publication
Deposition date:2023-07-07
Release date:2025-01-15
PDBID:8tez
Status:HPUB -- hold until publication
Title:Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH
Authors:Donkor, A.K., Safo, M.K., Musayev, F.N.
Deposition date:2023-07-07
Release date:2024-08-01
PDBID:8te8
Status:HPUB -- hold until publication
Title:Crystal Structure of Pyridoxal Reductase (PDXI)
Authors:Donkor, A.K., Safo, M.K., Musayev, F.N.
Deposition date:2023-07-05
Release date:2024-08-01
PDBID:8tcb
Status:HPUB -- hold until publication
Deposition date:2023-06-30
Release date:2024-12-30
PDBID:8tbr
Status:HPUB -- hold until publication
Title:Crystal Structure of Dihydrofolate reductase (DHFR) from Mycobacterium ulcerans Agy99 in complex with NADP and inhibitor MAM758
Authors:Seattle Structural Genomics Center for Infectious Disease, Seattle Structural Genomics Center for Infectious Disease (SSGCID)
Deposition date:2023-06-29
PDBID:8tbc
Status:HPUB -- hold until publication
Title:Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg
Authors:Abhiraman, G.C., Jude, K.M., Garcia, K.C.
Deposition date:2023-06-28
Release date:2024-12-28
PDBID:8tbb
Status:HPUB -- hold until publication
Title:F9S, novel TIM-3 targeting antibody, bound to IgV domain of TIM-3
Authors:Oganesyan, V., van Dyk, N., Mazor, Y., Yang, C.
Deposition date:2023-06-28
PDBID:8tb9
Status:HPUB -- hold until publication
Deposition date:2023-06-28
Release date:2024-12-18

223790

數據於2024-08-14公開中

PDB statisticsPDBj update infoContact PDBjnumon