PDBID: | 8ucp | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 8uco | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 8ucn | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 8ucm | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 8ucl | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 8uck | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 8ucj | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 8uca | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-26 | Release date: | 2025-01-31 |
|
PDBID: | 8uc5 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-25 |
|
PDBID: | 8ubv | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of dimeric FBXL17-BACH1BTB E3 ubiquitin ligase complex | Authors: | Shi, H., Cao, S., Zheng, N. | Deposition date: | 2023-09-25 | Release date: | 2025-03-26 |
|
PDBID: | 8ubt | Status: | HPUB -- hold until publication | Title: | Structure of SCF-FBXL17-BACH1BTB E3 ligase complex | Authors: | Shi, H., Cao, S. | Deposition date: | 2023-09-24 | Release date: | 2025-03-26 |
|
PDBID: | 8ubs | Status: | HPUB -- hold until publication | Title: | Crystal structure of NrdJ-1 split intein fusion | Authors: | Kofoed, C., Ye, X., Jeffrey, P.D., Muir, T.W. | Deposition date: | 2023-09-24 |
|
PDBID: | 8ubq | Status: | HPUB -- hold until publication | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and 2-benzyl-4-phenylthiazole-5-carboxylic acid | Authors: | Wang, G., Heras, B. | Deposition date: | 2023-09-24 | Sequence: | >Entity 1 AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
PDBID: | 8ubp | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubo | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubn | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubm | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubl | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubk | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubj | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubi | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubf | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-22 |
|
PDBID: | 8ube | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-22 |
|
PDBID: | 8ubd | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-22 |
|
PDBID: | 8ubc | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-22 |
|