PDBID: | 8thf | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-15 |
|
PDBID: | 8tgz | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-13 |
|
PDBID: | 8tgx | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2023-07-13 |
|
PDBID: | 8tgw | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of 1059 SOSIP trimer purified via Galanthus nivalis lectin chromatography | Authors: | Pothula, K., Parsons, R.J., Acharya, P. | Deposition date: | 2023-07-13 |
|
PDBID: | 8tgv | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-13 |
|
PDBID: | 8tgu | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of BG505 SOSIP trimer purified via Galanthus nivalis lectin chromatography | Authors: | Parsons, R.J., Pothula, K., Acharya, P. | Deposition date: | 2023-07-13 |
|
PDBID: | 8tgt | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-13 |
|
PDBID: | 8tgs | Status: | HPUB -- hold until publication | Title: | The crystal structure of the post-reactive state of UDP-sugar pyrophosphorylase from Leishmania major in complex with product UDP-Glucose and by-product analog VO4 (orthovanadate) | Authors: | Prakash, O., Fuehring, J.I., Baruch, P., Routier, F.H., Fedorov, R. | Deposition date: | 2023-07-13 | Release date: | 2025-01-13 |
|
PDBID: | 8tgf | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-12 |
|
PDBID: | 8tga | Status: | HPUB -- hold until publication | Title: | Complex of NPR1 ectodomain and REGN5381 Fab in an active-like state with no ANP bound | Authors: | Franklin, M.C., Romero Hernandez, A. | Deposition date: | 2023-07-12 |
|
PDBID: | 8tg9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-12 |
|
PDBID: | 8tg2 | Status: | HPUB -- hold until publication | Title: | The crystal structure of the post-reactive state of UDP-sugar pyrophosphorylase from Leishmania major in complex with products UDP-Glucose and PPi | Authors: | Prakash, O., Fuehring, J.I., Baruch, P., Routier, F.H., Fedorov, R. | Deposition date: | 2023-07-12 | Release date: | 2025-01-12 |
|
PDBID: | 8tg0 | Status: | HPUB -- hold until publication | Title: | Solution NMR structure of the cold shock domain of the Arabidopsis thaliana glycine-rich protein AtGRP2 | Authors: | Pougy, K.C., Almeida, F.C.L., Pinheiro, A.S. | Deposition date: | 2023-07-12 | Release date: | 2025-01-12 |
|
PDBID: | 8tfw | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-12 |
|
PDBID: | 8tft | Status: | HPUB -- hold until publication | Title: | Fab of O13-1 human IgG1 antibody bound to IgV domain of human TIM-3 | Authors: | Oganesyan, V.Y., van Dyk, N., Mazor, Y., Yang, C. | Deposition date: | 2023-07-11 |
|
PDBID: | 8tfj | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-11 |
|
PDBID: | 8tfe | Status: | HPUB -- hold until publication | Title: | Crystal structure of Fab fragment of anti-HCV E2 antibody (CBH-7) | Authors: | Shahid, S., Mariuzza, R.A. | Deposition date: | 2023-07-10 |
|
PDBID: | 8tfd | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-10 | Release date: | 2025-01-08 |
|
PDBID: | 8tf6 | Status: | HPUB -- hold until publication | Title: | X-ray Crystal Structure Determination of Dihydromethanopterin Reductase A (DmrA) from Methylobacterium extorquens AM1 by Se-SAD Phasing in a F222 Crystal form at 2.70 Angstroms Resolution | Authors: | Axelrod, H.L., Rasche, M., Cascio, D., Arbing, M., Collazo, M.J., Potla, P.S., ? | Deposition date: | 2023-07-07 | Release date: | 2025-01-08 | Sequence: | >Entity 1 (MSE)IDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALT(MSE)GHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
PDBID: | 8tf5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-07 | Release date: | 2025-01-07 |
|
PDBID: | 8tf1 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH and Pyridoxal | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | Deposition date: | 2023-07-07 |
|
PDBID: | 8tf0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-07 | Release date: | 2025-01-15 |
|
PDBID: | 8tez | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | Deposition date: | 2023-07-07 |
|
PDBID: | 8tev | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-07 | Release date: | 2024-09-25 |
|
PDBID: | 8te8 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Pyridoxal Reductase (PDXI) | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | Deposition date: | 2023-07-05 |
|