PDBID: | 8tqy | Status: | HPUB -- hold until publication | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | Deposition date: | 2023-08-08 | Release date: | 2025-01-08 | Sequence: | >Entity 1 MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
PDBID: | 8tqw | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-08 |
|
PDBID: | 8tqu | Status: | HPUB -- hold until publication | Title: | MPI51 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-08 |
|
PDBID: | 8tqt | Status: | HPUB -- hold until publication | Title: | MPI52 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-08 |
|
PDBID: | 8tqr | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8tqq | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8tqn | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8tql | Status: | HPUB -- hold until publication | Title: | MPI54 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-07 |
|
PDBID: | 8tqj | Status: | HPUB -- hold until publication | Title: | MPI57 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-07 |
|
PDBID: | 8tqh | Status: | HPUB -- hold until publication | Title: | MPI68 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-07 |
|
PDBID: | 8tqf | Status: | HPUB -- hold until publication | Title: | Crystal structure of Soybean SHMT8 in complex with PLP-glycine and diglutamylated 5-formyltetrahydrofolate | Authors: | Owuocha, L.F., Beamer, L.J. | Deposition date: | 2023-08-07 |
|
PDBID: | 8tqc | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-06 |
|
PDBID: | 8tqb | Status: | AUTH -- processed, waiting for author review and approval | Title: | mGluR3 in the presence of the agonist LY379268 and PAM VU6023326 | Authors: | Strauss, A., Levitz, J. | Deposition date: | 2023-08-06 |
|
PDBID: | 8tq6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8tq5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8tq4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8tq2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 |
|
PDBID: | 8tq1 | Status: | HPUB -- hold until publication | Title: | HIV-1 BG505 Env SOSIP in complex with bovine Fab Bess4 and non-human primate Fab RM20A3 | Authors: | Ozorowski, G., Lee, W.H., Ward, A.B. | Deposition date: | 2023-08-06 |
|
PDBID: | 8tpx | Status: | HPUB -- hold until publication | Title: | Crosslinked 6-deoxyerythronolide B synthase (DEBS) Module 3 in complex with antibody fragment 1B2: trans-oriented 1B2 and ACP | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | Deposition date: | 2023-08-05 |
|
PDBID: | 8tpw | Status: | HPUB -- hold until publication | Title: | Crosslinked 6-deoxyerythronolide B synthase (DEBS) Module 3 in complex with antibody fragment 1B2: cis-oriented 1B2 and ACP | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | Deposition date: | 2023-08-05 |
|
PDBID: | 8tpu | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-05 |
|
PDBID: | 8tp0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-04 |
|
PDBID: | 8toz | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-04 |
|
PDBID: | 8toy | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-04 | Release date: | 2025-02-04 |
|
PDBID: | 8tox | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-04 |
|