| PDBID: | 8z54 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human SIRT5 in complex with succinylated Prx1 fragment | | Authors: | Yokoyama, T., Takayama, Y. | | Deposition date: | 2024-04-18 | | Sequence: | >Entity 1
MHHHHHHPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
>Entity 2
SKEYFSKQK
|
|
| PDBID: | 8z53 | | Status: | HPUB -- hold until publication | | Title: | Arabidopsis Dwarf14 (AtD14) co-crystallized in the presence of Zaxinone | | Authors: | Arold, S.T., Hameed, U.F.S. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z52 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z51 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z4z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4y | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the USP11 deubiquitinase domain | | Authors: | Zhengyang, Z., Yu, G., Yikang, A., Hongying, L. | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4x | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 D614G S with two ACE2 receptors binding (RB2) in prefusion conformation | | Authors: | Liu, Z., Xing, L. | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4v | | Status: | HPUB -- hold until publication | | Title: | LH2 complex from Ectothiorhodospira haloalkaliphila at near-atomic resolution | | Authors: | Burtseva, A.D., Baymukhametov, T.N., Popov, V.O., Ashikhmin, A.A., Boyko, K.M. | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4n | | Status: | HPUB -- hold until publication | | Title: | Pseudomurein Endoisopeptidase PeiR-C90A | | Authors: | Guo, L.Z., Wang, S.X., Bai, L.p. | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4i | | Status: | HPUB -- hold until publication | | Title: | crystal structure of Cdn1 in complex with cA3 | | Authors: | Zhang, W. | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4h | | Status: | HPUB -- hold until publication | | Title: | Pseudomurein Endoisopeptidase PeiR | | Authors: | Guo, L.Z., Wang, S.X., Bai, L.p. | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8z4f | | Status: | HPUB -- hold until publication | | Title: | Pseudomurein Endoisopeptidases PeiP | | Authors: | Guo, L., Bai, L. | | Deposition date: | 2024-04-17 |
|
