| PDBID: | 9cmm | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-15 |
|
| PDBID: | 9cml | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-15 |
|
| PDBID: | 9cmk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-15 |
|
| PDBID: | 9cmj | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of SARS-CoV-2 main protease drug resistant mutant (L50F, E166V) | | Authors: | Kovalevsky, A., Coates, L., Gerlits, O. | | Deposition date: | 2024-07-15 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMFNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMVLPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9cmg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-15 |
|
| PDBID: | 9cmf | | Status: | HPUB -- hold until publication | | Title: | Substrate bound DosP | | Authors: | Kumar, P., Kober, D.L. | | Deposition date: | 2024-07-15 |
|
| PDBID: | 9cme | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-15 |
|
| PDBID: | 9cmd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-14 |
|
| PDBID: | 9cmc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the peanut allergen Ara h 2 with two human derived Fab antibodies 22S1 and 23P34 | | Authors: | Pedersen, L.C., Mueller, G.A., Min, J. | | Deposition date: | 2024-07-14 |
|
| PDBID: | 9cmb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-13 |
|
| PDBID: | 9cma | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-13 |
|
| PDBID: | 9cm9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure-derived insights from blood factors binding to surfaces of different adenoviruses | | Authors: | Reddy, V.S., Ma, O.X. | | Deposition date: | 2024-07-13 |
|
| PDBID: | 9cm8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-13 |
|
| PDBID: | 9cm7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9cm6 | | Status: | HOLD -- hold until a certain date | | Title: | Horse liver alcohol dehydrogenase V203L in complex with NADH and N-cylcohexyl formamide | | Authors: | Mukherjee, S., Boxer, S.G. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9cm5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9cm4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9cm3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9cm2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure-derived insights from blood factors binding to surfaces of different adenoviruses | | Authors: | Reddy, V.S., Ma, O.X. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9cm1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9cm0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9clz | | Status: | HPUB -- hold until publication | | Title: | Novel designed icosahedral nanoparticle I3-A6 | | Authors: | Haas, C.M., Jasti, N., Dosey, A.M., Gillespie, R., Allen, J.D., Leaf, E.M., Crispin, M., DeForest, C., Kanekiyo, M., King, N.P. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9clx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9clw | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9clv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
