| PDBID: | 9gor | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Polyphosphate kinase 2-II (PPK2-II) from Lysinibacillus fusiformis Apo-form | | Authors: | Saleem-Batcha, R., Keppler, M., Kuge, M., Andexer, J.N. | | Deposition date: | 2024-09-06 |
|
| PDBID: | 9goq | | Status: | HPUB -- hold until publication | | Title: | Structure of the S.aureus MecA protein, in complex with ClpC | | Authors: | Carroni, M., Azinas, S. | | Deposition date: | 2024-09-06 |
|
| PDBID: | 9gop | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CDK2-cyclin E1 bound by 2-[(2S)-1-(9-ethyl-6-{[1-methyl-3-(methylsulfonyl)-1H-pyrazol-5-yl]amino}-9H-purin-2-yl)-4,4-difluoro-2-pyrrolidinyl]-2-propanol. | | Authors: | Collie, G.W. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9goo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human carbonic anhydrase II in complex with PCI-27483 | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gon | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of DPP9 in complex with sulphostin | | Authors: | Sewald, L., Tabak, W.W.A., Fehr, L., Zolg, S., Najdzion, M., Verhoef, C.J.A., Podlesainski, D., Geiss-Friedlander, R., Lammens, A., Kaschani, F., Hellerschmied, D., Huber, R., Kaiser, M. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gom | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of limonene epoxide hydrolase LEH 31 | | Authors: | Levy, C.W. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gol | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of limonene epoxide hydrolase LEH 19 | | Authors: | Levy, C.W. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gok | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray structure of lysozyme obtained upon reaction with the dioxidovanadium(V) complex with (E)-N''-(1-(2-hydroxy-5-methoxyphenyl)ethylidene)furan-2-carbohydrazide) | | Authors: | Paolillo, M., Ferraro, G., Merlino, A. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9goj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9goi | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9goh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gog | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray structure of lysozyme obtained upon reaction with the dioxidovanadium(V) complex with furan-2-carboxylic acid (3-ethoxy-2-hydroxybenzylidene)hydrazide | | Authors: | Paolillo, M., Ferraro, G., Merlino, A. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gof | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 | | Sequence: | >Entity 1
MQSEQWRSLSNVVWGKDLPAFTYAFSKTPLVLYDGGTTKQVGTYNFPVSKGMAGVYMSLEPGAIRELHWHANAAEWAYVMEGRTRITLTSPEGKVEIADVDKGGLWYFPRGWGHSIEGIGPDTAKFLLVFNDGTFSEGATFSVTDWLSHTPIAWVEENLGWTAAQVAQLPKKQVYISSYGPASGPLASATPQGQTAKIEVPHTHNLLGQQPLVSLGGNELRLASAKEFPGSFNMTGALIHLEPGAMRQLHWHPNADEWQYVLDGEMDLTVFASEGKASVSRLQQGDVGYVPKGYGHAIRNSSQKPLDIVVVFNDGDYQSIDLSTWLASNPSSVLGNTFQISPELTKKLPVQDTIFSLPTQP
|
|
| PDBID: | 9goe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9god | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of DPP9 in complex with N-phosphono-(S)-3-aminopiperidine-2-one-based inhibitor | | Authors: | Sewald, L., Tabak, W.W.A., Fehr, L., Zolg, S., Najdzion, M., Verhoef, C.J.A., Podlesainski, D., Geiss-Friedlander, R., Lammens, A., Kaschani, F., Hellerschmied, D., Huber, R., Kaiser, M. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9goc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of DPP9 Ser730Ala in complex with sulphostin. | | Authors: | Sewald, L., Tabak, W.W.A., Fehr, L., Zolg, S., Najdzion, M., Verhoef, C.J.A., Podlesainski, D., Geiss-Friedlander, R., Lammens, A., Kaschani, F., Hellerschmied, D., Huber, R., Kaiser, M. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gob | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9goa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9go9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9go8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9go7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9go6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9go5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9go4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9go3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-04 |
|
