| PDBID: | 9gve | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-24 |
|
| PDBID: | 9gvd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-24 |
|
| PDBID: | 9gvc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Halothiobacillus neapolitanus alpha-carboxysome T=4 mini-shell containing CTD truncated mutant of CsoSCA | | Authors: | Ng, P.C., Basle, A., Liu, L.N., Marles-Wright, J. | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9gvb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ruminococcus flavefaciens Coh-Doc complex between a group 2 Dockerin and the Cohesin from cell surface attached scaffoldin ScaE | | Authors: | Bule, P., Carvalho, A.L., Najmudin, S. | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9gva | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the gamma carbonic anhydrase from Porphyromonas gingivalis | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9gv9 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of Heparinase I from Bacteroides eggerthii in complex with calcium cofactor | | Authors: | Mycroft-West, C., Wu, L. | | Deposition date: | 2024-09-23 | | Release date: | 2025-09-23 |
|
| PDBID: | 9gv8 | | Status: | HPUB -- hold until publication | | Title: | N-Acyl-D-amino-acid deacylase (D-acylase) from Klebsiella pneumoniae in the absence of glycerol | | Authors: | Gavira, J.A., Martinez-Rodriguez, S. | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9gv7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9gv6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9gv5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9gv4 | | Status: | HPUB -- hold until publication | | Title: | TBA G-quadruplex binding nanobody (free form) | | Authors: | Pevec, M., Hadzi, S. | | Deposition date: | 2024-09-21 | | Sequence: | >Entity 1
QVQLQESGGGLVQAGGSLRLSCAASGSRFSSNTMTWYRQAPGKQREWVATMRSIGTTRYASSVEGRFTLSRDNAKNTVYLQMNSLKPEDTAVYYCNLRRGGGIYWGQGTQVTVSSHHHHHH
|
|
| PDBID: | 9gv3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the complex between Nb474 mutant R53A,D125A and Trypanosoma congolense fructose-1,6-bisphosphate aldolase | | Authors: | McNae, I.W., Dornan, J., Walkinshaw, M.D. | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9gv2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-20 |
|
| PDBID: | 9gv1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-20 |
|
| PDBID: | 9gv0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Antibody fragment in complex with methylated ERG peptide | | Authors: | Arinkin, V., Sgrignani, J., Cavalli, A. | | Deposition date: | 2024-09-20 |
|
| PDBID: | 9guz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-20 |
|
| PDBID: | 9guy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SARS-CoV-2 methyltransferase nsp10-16 in complex with SAM and theophylline derivative LAS 54571098 | | Authors: | Kremling, V., Sprenger, J., Oberthuer, D., Kiene, A. | | Deposition date: | 2024-09-20 |
|
| PDBID: | 9gux | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 30S-TEC (TEC in expressome position) Inactive state 1 | | Authors: | Rahil, H., Weixlbaumer, A., Webster, M.W. | | Deposition date: | 2024-09-20 |
|
| PDBID: | 9guw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 30S-TEC (TEC in expressome position) Inactive state 2 | | Authors: | Rahil, H., Weixlbaumer, A., Webster, M.W. | | Deposition date: | 2024-09-20 |
|
| PDBID: | 9guv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-20 |
|
| PDBID: | 9guu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 30S mRNA delivery complex (consensus) | | Authors: | Rahil, H., Weixlbaumer, A., Webster, M.W. | | Deposition date: | 2024-09-20 |
|
| PDBID: | 9gut | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 30S mRNA delivery complex (bS1 resolved) | | Authors: | Rahil, H., Weixlbaumer, A., Webster, M.W. | | Deposition date: | 2024-09-20 |
|
| PDBID: | 9gus | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 30S mRNA delivery complex TEC resolved (30S only) | | Authors: | Rahil, H., Weixlbaumer, A., Webster, M.W. | | Deposition date: | 2024-09-20 |
|
| PDBID: | 9gur | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 30S mRNA delivery complex TEC resolved (TEC only) | | Authors: | Rahil, H., Weixlbaumer, A., Webster, M.W. | | Deposition date: | 2024-09-20 |
|
| PDBID: | 9guq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 30S PIC (Pre-Initiation complex) | | Authors: | Rahil, H., Weixlbaumer, A., Webster, M.W. | | Deposition date: | 2024-09-20 |
|
