PDBID: | 8rbj | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbh | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbg | Status: | HPUB -- hold until publication | Title: | CryoEM structure of primed myosin-5a (ADP-Pi state) | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbf | Status: | HPUB -- hold until publication | Title: | CryoEM structure of the post-powerstroke actomyosin-5a complex | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbe | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbd | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbc | Status: | HPUB -- hold until publication | Title: | p53-Y220C Core Domain Covalently Bound to 3-amino-5-chloropyrazine-2,6-dicarbonitrile Soaked at 5 mM | Authors: | Stahlecker, J., Klett, T., Stehle, T., Boeckler, F.M. | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbb | Status: | HPUB -- hold until publication | Title: | p53-Y220C Core Domain Covalently Bound to 2,5,6-trifluoropyridine-3-carbonitrile Soaked at 40 mM | Authors: | Stahlecker, J., Klett, T., Stehle, T., Boeckler, F.M. | Deposition date: | 2023-12-04 |
|
PDBID: | 8rba | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rb2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8rb1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8rb0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8raz | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8ray | Status: | HPUB -- hold until publication | Title: | ParA in complex with ATP | Authors: | Mais, C.-N., Bange, G. | Deposition date: | 2023-12-01 |
|
PDBID: | 8rax | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8raw | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8rav | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8rau | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8rar | Status: | HPUB -- hold until publication | Title: | Crystal structure of chimeric human carbonic anhydrase IX with N-butyl-4-chloro-2-(cyclohexylsulfanyl)-5-sulfamoylbenzamide | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | Deposition date: | 2023-12-01 | Sequence: | >Entity 1 MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8raq | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8rap | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Sen1-ADP.BeF3 bound RNA Polymerase II pre-termination complex | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | Deposition date: | 2023-12-01 |
|
PDBID: | 8rao | Status: | HPUB -- hold until publication | Title: | Structure of Sen1-ADP.BeF3-RNA complex | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | Deposition date: | 2023-12-01 |
|
PDBID: | 8ran | Status: | HPUB -- hold until publication | Title: | Structure of Sen1-RNA complex | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | Deposition date: | 2023-12-01 |
|
PDBID: | 8ram | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8ral | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|